"IL36A" Related Products

Expand
Expand

GMP Recombinant Human IL36A protein

Cat.No.: IL36A-4338HG
Product Overview: Recombinant Human IL36A was produced in E. coli using non-animal reagents in an animal-free facility under cGMP guidelines.
Description: Interleukin-36 (IL-36) is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. Studies showed IL-36α is mainly found in skin and lymphoid tissues, but also in fetal brain, trachea, stomach and intestine. Notably, IL-36 alpha is the only novel IL-1 family member expressed on T-cells. Recombinant human interleukin-36 alpha contains 158 amino acids residues which is a single non-glycosylated polypeptide and it is 30 % a.a. identical to IL-1ra, and 27 %, 31 %, 36 %, 46 %, 57% and 28 % a.a. identical to IL-1β, IL-36Ra/IL-1F5, IL-37/IL-1F7, IL-36β/IL-1F8, IL-36γ/IL-1F9 and IL-1F10.
Source: E. coli
Species: Human
Form: Lyophilized from a 0.2 μm filtered concentrated solution in 2 × PBS, pH 7.4.
Bio-activity: Fully biologically active when compared to standard. The specific activity determined by its ability in a functional ELISA. Immobilized rHuIL-36α at 1 µg/mL can bind recombinant human IL-1 Rrp2 Fc Chimera with a range of 0.15-5 µg/mL.
Molecular Mass: Approximately 17.7 kDa, a single non-glycosylated polypeptide chain containing 158 amino acids.
AA Sequence: MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Endotoxin: Less than 1 EU/μg of rHuIL-36α, 158a.a. as determined by LAL method.
Purity: > 95 % by SDS-PAGE and HPLC analyses.
Storage: This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably des centigradecated. Upon reconsitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 centigrade to -70 centigrade. Avoid repeated freeze/thaw centigrade centigradeles.
Reconstitution: Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Quality Statement: Our GMP proteins are produced according to relevant sections of the following documents: WHO TRS, No. 822, 1992 Annex 1, Good Manufacturing Practices for Biological Products; USP Chapter 1043, Ancillary Materials for Cell, Gene and Tissue-Engineered Products and USP Chapter 92, Growth Factors and Cytokines Used in Cell Therapy Manufacturing.
Shipping: The product is shipped at ambient temperature. Upon receipt, store it immediately at the recommended temperature.
Gene Name: IL36A interleukin 36, alpha [ Homo sapiens (human) ]
Official Symbol: IL36A
Synonyms: FIL1; FIL1E; IL1F6; IL-1F6; IL1(EPSILON); FIL1(EPSILON)
Gene ID: 27179
mRNA Refseq: NM_014440.2
Protein Refseq: NP_055255.1
MIM: 605509
UniProt ID: Q9UHA7

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.