Description : |
This gene encodes an immunoregulatory cytokine produced primarily by activated Th2 cells. This cytokine is involved in several stages of B-cell maturation and differentiation. It up-regulates CD23 and MHC class II expression, and promotes IgE isotype switching of B cells. This cytokine down-regulates macrophage activity, thereby inhibits the production of pro-inflammatory cytokines and chemokines. This cytokine is found to be critical to the pathogenesis of allergen-induced asthma but operates through mechanisms independent of IgE and eosinophils. This gene, IL3, IL5, IL4, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL4. [provided by RefSeq, Jul 2008] |
Source : |
E. coli |
Species : |
Human |
Tag : |
His(C-ter) |
Form : |
Powder |
Bio-activity : |
Determined by its ability to induce TF-1 cells proliferation. The ED50 for this effect is < 0.8 ng/mL. The specific activity of recombinant human IL-13 is approximately > 1 x 10^6 IU/mg. |
AA Sequence : |
MSAPFSFLSNVKYNFMRIIKYEFIL NDALNQSIIRANDQYLTAAALHNLD EAVKFDMSAPFSFLSNVKYNFMRII KYEFIL NDALNQSIIRANDQYLTAAALHNLD EAVKFDFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSI TDFQILENQA |
Endotoxin : |
Endotoxin level is less than 0.01 EU/μg of the protein, as determined by the LAL test. |
Purity : |
> 95% (by SDS-PAGE) |
Applications : |
SDS-PAGE |
Notes : |
For laboratory research only, not for drug, diagnostic or other use. |
Storage : |
Lyophilized protein should be stored at -20°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening. |
Storage Buffer : |
PBS (pH 8.0) |
Reconstitution : |
It is recommended to reconstitute the lyophilized protein in sterile water to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min at room temperature to make sure the protein is dissolved completely. |