Recombinant Full Length Human CST4 Protein
Cat.No. : | CST4-97HF |
Product Overview : | Recombinant full length Human Cystatin S with N terminal proprietary tag; Predicted MWt 41.58 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a type 2 salivary cysteine peptidase inhibitor. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 41.580kDa inclusive of tags |
Protein Length : | 141 amino acids |
AA Sequence : | MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLN DEWVQRALHFAISEYNKATEDEYYRRPLQVLRAREQTFGG VNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF EIYEVPWEDRMSLVNSRCQEA |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | CST4 cystatin S [ Homo sapiens ] |
Official Symbol : | CST4 |
Synonyms : | CST4; cystatin S; cystatin-S |
Gene ID : | 1472 |
mRNA Refseq : | NM_001899 |
Protein Refseq : | NP_001890 |
MIM : | 123857 |
UniProt ID : | P01036 |
Products Types
◆ Recombinant Protein | ||
CST4-1304R | Recombinant Rat CST4 Protein, His (Fc)-Avi-tagged | +Inquiry |
CST4-189H | Recombinant Human CST4 Protein, His-tagged | +Inquiry |
CST4-3212H | Recombinant Human CST4 protein(Met1-Ala141), His-tagged | +Inquiry |
CST4-3353H | Recombinant Human CST4 Protein, MYC/DDK-tagged | +Inquiry |
CST4-2027H | Recombinant Human CST4 Protein, GST-tagged | +Inquiry |
◆ Lysates | ||
CST4-2241HCL | Recombinant Human CST4 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All CST4 Products
Required fields are marked with *
My Review for All CST4 Products
Required fields are marked with *
0
Inquiry Basket