Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human CYP3A4 Protein

Cat.No. : CYP3A4-117HF
Product Overview : Recombinant full length Human Cytochrome P450 3A4 protein with an N terminal proprietary tag; predicted MW: 81.4 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum and its expression is induced by glucocorticoids and some pharmacological agents. This enzyme is involved in the metabolism of approximately half the drugs in use today, including acetaminophen, codeine, cyclosporin A, diazepam and erythromycin. The enzyme also metabolizes some steroids and carcinogens. This gene is part of a cluster of cytochrome P450 genes on chromosome 7q21.1. Previously another CYP3A gene, CYP3A3, was thought to exist; however, it is now thought that this sequence represents a transcript variant of CYP3A4. Alternatively spliced transcript variants encoding different isoforms have been identified.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 81.400kDa
Protein Length : 503 amino acids
AA Sequence : MALIPDLAMETWLLLAVSLVLLYLYGTHSHGLFKKLGIPG PTPLPFLGNILSYHKGFCMFDMECHKKYGKVWGFYDGQQP VLAITDPDMIKTVLVKECYSVFTNRRPFGPVGFMKSAISI AEDEEWKRLRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNL RREAETGKPVTLKDVFGAYSMDVITSTSFGVNIDSLNNPQ DPFVENTKKLLRFDFLDPFFLSITVFPFLIPILEVLNICV FPREVTNFLRKSVKRMKESRLEDTQKHRVDFLQLMIDSQN SKETESHKALSDLELVAQSIIFIFAGYETTSSVLSFIMYE LATHPDVQQKLQEEIDAVLPNKAPPTYDTVLQMEYLDMVV NETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYA LHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPR NCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLG GLLQPEKPVVLKVESRDGTVSGA
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : CYP3A4 cytochrome P450, family 3, subfamily A, polypeptide 4 [ Homo sapiens ]
Official Symbol : CYP3A4
Synonyms : CYP3A4; cytochrome P450, family 3, subfamily A, polypeptide 4; CYP3A3, cytochrome P450, subfamily IIIA (niphedipine oxidase), polypeptide 4; cytochrome P450 3A4
Gene ID : 1576
mRNA Refseq : NM_001202855
Protein Refseq : NP_001189784
MIM : 124010
UniProt ID : P08684

Products Types

◆ Recombinant Protein
CYP3A4-2273H Recombinant Human CYP3A4 Protein, GST-tagged +Inquiry
CYP3A4-128C Active Recombinant Cynomolgus CYP3A4 Protein +Inquiry
CYP3A4-983R Recombinant Rhesus Macaque CYP3A4 Protein, His (Fc)-Avi-tagged +Inquiry
CYP3A4-1301H Recombinant Human CYP3A4 Protein, His-tagged +Inquiry
CYP3A4-81H Active Recombinant Human CYP3A4 Protein +Inquiry

See All CYP3A4 Recombinant Protein

◆ Lysates
CYP3A4-436HCL Recombinant Human CYP3A4 cell lysate +Inquiry

See All CYP3A4 Lysates

◆ Assay kits
Kit-2142 Cytochrome P450 3A4 Inhibitor Screening Kit +Inquiry
Kit-1918 Cytochrome P450 3A4 (CYP3A4) Activity Assay Kit +Inquiry

See All CYP3A4 Assay kits

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends