Recombinant Full Length Human HSD11B1 Protein
Cat.No. : | HSD11B1-238HF |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-292 of Human HSD11B1, with an N-terminal proprietary tag, predicted MWt 57.86 kDa |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a microsomal enzyme that catalyzes the conversion of the stress hormone cortisol to the inactive metabolite cortisone. In addition, the encoded protein can catalyze the reverse reaction, the conversion of cortisone to cortisol. Too much cortisol can lead to central obesity, and a particular variation in this gene has been associated with obesity and insulin resistance in children. Mutations in this gene and H6PD (hexose-6-phosphate dehydrogenase (glucose 1-dehydrogenase)) are the cause of cortisone reductase deficiency. Alternate splicing results in multiple transcript variants encoding the same protein. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 57.860kDa inclusive of tags |
Protein Length : | 292 amino acids |
AA Sequence : | MAFMKKYLLPILGLFMAYYYYSANEEFRPEMLQGKKVIVT GASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLE LGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNH ITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQ SNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKE YSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEE CALEIIKGGALRQEEVYYDSSLWTTLLIRNPCRKILEFLY STSYNMDRFINK |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | HSD11B1 hydroxysteroid (11-beta) dehydrogenase 1 [ Homo sapiens ] |
Official Symbol : | HSD11B1 |
Synonyms : | HSD11B1; hydroxysteroid (11-beta) dehydrogenase 1; HSD11, HSD11B; corticosteroid 11-beta-dehydrogenase isozyme 1; SDR26C1; short chain dehydrogenase/reductase family 26C; member 1 |
Gene ID : | 3290 |
mRNA Refseq : | NM_001206741 |
Protein Refseq : | NP_001193670 |
MIM : | 600713 |
UniProt ID : | P28845 |
Products Types
◆ Recombinant Protein | ||
Hsd11b1-1636M | Recombinant Mouse Hsd11b1 Protein, His-tagged | +Inquiry |
HSD11B1-5060H | Recombinant Human HSD11B1 Protein, GST-tagged | +Inquiry |
HSD11B1-019H | Recombinant Human HSD11B1 Protein, His-tagged | +Inquiry |
HSD11B1-0320H | Recombinant Human HSD11B1 Protein (M1-K292), His/Strep tagged | +Inquiry |
HSD11B1-4330M | Recombinant Mouse HSD11B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
HSD11B1-5381HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
HSD11B1-5380HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket