Recombinant Full Length Human MEOX2 Protein
Cat.No. : | MEOX2-304HF |
Product Overview : | Recombinant full length Human MEOX 2 with N terminal proprietary tag, 59.07 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of a subfamily of non-clustered, diverged, antennapedia-like homeobox-containing genes. The encoded protein may play a role in the regulation of vertebrate limb myogenesis. Mutations in the related mouse protein may be associated with craniofacial and/or skeletal abnormalities, in addition to neurovascular dysfunction observed in Alzheimers disease. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 59.070kDa inclusive of tags |
Protein Length : | 303 amino acids |
AA Sequence : | MEHPLFGCLRSPHATAQGLHPFSQSSLALHGRSDHMSYPE LSTSSSSCIIAGYPNEEGMFASQHHRGHHHHHHHHHHHHQ QQQHQALQTNWHLPQMSSPPSAARHSLCLQPDSGGPPELG SSPPVLCSNSSSLGSSTPTGAACAPGDYGRQALSPAEAEK RSGGKRKSDSSDSQEGNYKSEVNSKPRKERTAFTKEQIRE LEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK WKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQ QTGDSIANEDSHDSDHSSEHAHL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | MEOX2 mesenchyme homeobox 2 [ Homo sapiens ] |
Official Symbol : | MEOX2 |
Synonyms : | MEOX2; mesenchyme homeobox 2; GAX, mesenchyme homeo box 2 (growth arrest specific homeo box) , mesenchyme homeobox 2 (growth arrest specific homeo box); homeobox protein MOX-2; growth arrest specific homeobox; MOX2 |
Gene ID : | 4223 |
mRNA Refseq : | NM_005924 |
Protein Refseq : | NP_005915 |
MIM : | 600535 |
UniProt ID : | P50222 |
Products Types
◆ Recombinant Protein | ||
MEOX2-5477M | Recombinant Mouse MEOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEOX2-4440H | Recombinant Human MEOX2 Protein, GST-tagged | +Inquiry |
MEOX2-3303R | Recombinant Rat MEOX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
MEOX2-29604TH | Recombinant Human MEOX2 | +Inquiry |
MEOX2-240H | Recombinant Human mesenchyme homeobox 2, His-tagged | +Inquiry |
◆ Lysates | ||
MEOX2-4365HCL | Recombinant Human MEOX2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket