Recombinant Full Length Human MGST1 Protein
Cat.No. : | MGST1-305HF |
Product Overview : | Recombinant full length Human Microsomal Glutathione S-transferase 1 with a N terminal proprietary tag; predicted MW: 42.79 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
Description : | The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Four transcript variants of this gene encode one protein isoform. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 42.790kDa inclusive of tags |
Protein Length : | 155 amino acids |
AA Sequence : | MVDLTQVMDDEVFMAFASYATIILSKMMLMSTATAFYRLT RKVFANPEDCVAFGKGENAKKYLRTDDRVERVRRAHLNDL ENIIPFLGIGLLYSLSGPDPSTAILHFRLFVGARIYHTIA YLTPLPQPNRALSFFVGYGVTLSMAYRLLKSKLYL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | MGST1 microsomal glutathione S-transferase 1 [ Homo sapiens ] |
Official Symbol : | MGST1 |
Synonyms : | MGST1; microsomal glutathione S-transferase 1; GST12; MGST I |
Gene ID : | 4257 |
mRNA Refseq : | NM_020300 |
Protein Refseq : | NP_064696 |
MIM : | 138330 |
UniProt ID : | P10620 |
Products Types
◆ Recombinant Protein | ||
MGST1-3473H | Recombinant Human MGST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MGST1-5309H | Recombinant Human MGST1 Protein, GST-tagged | +Inquiry |
Mgst1-1777R | Recombinant Rat Mgst1 Protein, His-tagged | +Inquiry |
MGST1-438C | Recombinant Cynomolgus Monkey MGST1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MGST1-2439H | Recombinant Human MGST1 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
MGST1-1110HCL | Recombinant Human MGST1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket