Recombinant Full Length Human MTMR1 Protein, GST-tagged
Cat.No. : | MTMR1-6533HF |
Product Overview : | Human MTMR1 full-length ORF ( AAH11250, 1 a.a. - 38 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined. [provided by RefSeq |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 29.92 kDa |
Protein Length : | 38 amino acids |
AA Sequence : | MLSLPAPLRVNRGLWQLCTGAGLWLLQGALPVTRSWAV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name : | MTMR1 myotubularin related protein 1 [ Homo sapiens ] |
Official Symbol : | MTMR1 |
Synonyms : | MTMR1; myotubularin related protein 1; myotubularin-related protein 1; |
Gene ID : | 8776 |
mRNA Refseq : | NM_003828 |
Protein Refseq : | NP_003819 |
MIM : | 300171 |
UniProt ID : | Q13613 |
Products Types
◆ Recombinant Protein | ||
MTMR1-5784M | Recombinant Mouse MTMR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MTMR1-2192H | Recombinant Human MTMR1 Protein, MYC/DDK-tagged | +Inquiry |
MTMR1-5711H | Recombinant Human MTMR1 Protein, GST-tagged | +Inquiry |
Mtmr1-4214M | Recombinant Mouse Mtmr1 Protein, Myc/DDK-tagged | +Inquiry |
MTMR1-10201M | Recombinant Mouse MTMR1 Protein | +Inquiry |
◆ Lysates | ||
MTMR1-1147HCL | Recombinant Human MTMR1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket