Recombinant Full Length Human PDX1 Protein
Cat.No. : | PDX1-367HF |
Product Overview : | Recombinant full length protein of Human PDX1 with proprietary tag; predicted MW 58.13 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 58.130kDa inclusive of tags |
Protein Length : | 283 amino acids |
AA Sequence : | MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGR QPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVA HLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLE LEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMK WKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ EPR |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | PDX1 pancreatic and duodenal homeobox 1 [ Homo sapiens ] |
Official Symbol : | PDX1 |
Synonyms : | PDX1; pancreatic and duodenal homeobox 1; insulin promoter factor 1, homeodomain transcription factor , IPF1; pancreas/duodenum homeobox protein 1; IDX 1; MODY4; PDX 1; somatostatin transcription factor 1; STF 1 |
Gene ID : | 3651 |
mRNA Refseq : | NM_000209 |
Protein Refseq : | NP_000200 |
MIM : | 600733 |
UniProt ID : | P52945 |
Products Types
◆ Recombinant Protein | ||
PDX1-4022R | Recombinant Rat PDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pdx1-4780M | Recombinant Mouse Pdx1 Protein, Myc/DDK-tagged | +Inquiry |
Pdx1-2749R | Recombinant Rat Pdx1 Protein, His&GST-tagged | +Inquiry |
PDX1-1642H | Recombinant Human PDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDX1-6619M | Recombinant Mouse PDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
PDX1-3318HCL | Recombinant Human PDX1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionStudying the regulatory mechanism of PDX1 requires a combination of various experimental methods and techniques, such as gene knockout, transcriptome analysis, and protein-protein interactions.
Abnormal PDX1 levels may indicate pancreas-related diseases such as diabetes, pancreatitis, and pancreatic cancer.
Mutations in PDX1 can be detected and analyzed by methods such as whole-genome sequencing or target region sequencing to understand the impact of mutations on protein structure and function.
The types of mutations in PDX1 include point mutations, insertions/deletions, duplications, etc., which may cause structural and functional abnormalities of the protein.
PDX1 has a complex relationship with other genes or proteins, and can interact with other genes or proteins and participate in a variety of biochemical reactions.
It can be used as a biomarker in medical treatment to help monitor disease progression and treatment efficacy. In addition, therapeutics targeting PDX1, such as gene therapy or modulating its expression, are also being studied.
Customer Reviews (3)
Write a reviewThe expression was better at high humidity.
It is stable in clinical trials.
It has stable expression in signal transduction.
Ask a Question for All PDX1 Products
Required fields are marked with *
My Review for All PDX1 Products
Required fields are marked with *
Inquiry Basket