Recombinant Full Length Human PPP6C Protein
Cat.No. : | PPP6C-400HF |
Product Overview : | Recombinant full length Human PPP6C with N terminal proprietary tag; Predicted MW 59.29 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes the catalytic subunit of protein phosphatase, a component of a signaling pathway regulating cell cycle progression. Splice variants encoding different protein isoforms exist. The pseudogene of this gene is located on chromosome X. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 59.290kDa inclusive of tags |
Protein Length : | 305 amino acids |
AA Sequence : | MAPLDLDKYVEIARLCKYLPENDLKRLCDYVCDLLLEESN VQPVSTPVTVCGDIHGQFYDLCELFRTGGQVPDTNYIFMG DFVDSGYYSLETFTYLLALKAKWPDRITLLRGNHESRQIT QVYGFYDECQTKYGNANAWRYCTKVLDMLTVAALIDEQIL CVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWSDPE DVDTWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLV HEGYKFMFDEKLVTVWSAPNYCYRCGNIASIMVFKDVNTR EPKLFRAVPDSERVIPPRTTTPYFL |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | PPP6C protein phosphatase 6, catalytic subunit [ Homo sapiens ] |
Official Symbol : | PPP6C |
Synonyms : | PPP6C; protein phosphatase 6, catalytic subunit; serine/threonine-protein phosphatase 6 catalytic subunit; PP6 |
Gene ID : | 5537 |
mRNA Refseq : | NM_001123355 |
Protein Refseq : | NP_001116827 |
MIM : | 612725 |
UniProt ID : | O00743 |
Products Types
◆ Recombinant Protein | ||
PPP6C-7046M | Recombinant Mouse PPP6C Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP6C-4305R | Recombinant Rat PPP6C Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP6C-3597C | Recombinant Chicken PPP6C | +Inquiry |
PPP6C-11238Z | Recombinant Zebrafish PPP6C | +Inquiry |
PPP6C-29541TH | Recombinant Human PPP6C | +Inquiry |
◆ Lysates | ||
PPP6C-1407HCL | Recombinant Human PPP6C cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket