Recombinant Full Length Human RAG2 Protein
Cat.No. : | RAG2-425HF |
Product Overview : | Recombinant full length Human RAG2 with N terminal proprietary tag; Predicted MWt 84.04 kDa inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a protein that is involved in the initiation of V(D)J recombination during B and T cell development. This protein forms a complex with the product of the adjacent recombination activating gene 1, and this complex can form double-strand breaks by cleaving DNA at conserved recombination signal sequences. The recombination activating gene 1 component is thought to contain most of the catalytic activity, while the N-terminal of the recombination activating gene 2 component is thought to form a six-bladed propeller in the active core that serves as a binding scaffold for the tight association of the complex with DNA. A C-terminal plant homeodomain finger-like motif in this protein is necessary for interactions with chromatin components, specifically with histone H3 that is trimethylated at lysine 4. Mutations in this gene cause Omenn syndrome, a form of severe combined immunodeficiency associated with autoimmune-like symptoms. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 84.04 kDa inclusive of tags |
Protein Length : | 527 amino acids |
AA Sequence : | MSLQMVTVSNNIALIQPGFSLMNFDGQVFFFGQKGWPKRS CPTGVFHLDVKHNHVKLKPTIFSKDSCYLPPLRYPATCTF KGSLESEKHQYIIHGGKTPNNEVSDKIYVMSIVCKNNKKV TFRCTEKDLVGDVPEARYGHSINVVYSRGKSMGALFGGRS YMPSTHRTTEKWNSVADCLPCVFLVDFEFGCATSYILPEL QDGLSFHVSIAKNDTIYILGGHSLANNIRPANLYRIRVDL PLGSPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLE NQKRMICNIISLEDNKIEIREMETPDWTPDIKHSKIWFGS NTGNGTVFLGIPGDNKQVVSEGFYFYMLKCAEDDTNEEQT TFTNSQTSTEDPGDSTPFEDSEEFCFSAEANSFDGDDEFD TYNEDDEEDESETGYWITCCPTCDVDINTWVPFYSTELNK PAMIYCSHGDGHWVHAQCMDLAERTLIHLSAGSNKYYCNE HVEIARALHTPQRVLPLKKPPMKSLRKKGSGKILTPAKKS FLRRLFD |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | RAG2 recombination activating gene 2 [ Homo sapiens ] |
Official Symbol : | RAG2 |
Synonyms : | RAG2; recombination activating gene 2; V(D)J recombination-activating protein 2 |
Gene ID : | 5897 |
mRNA Refseq : | NM_000536 |
Protein Refseq : | NP_000527 |
MIM : | 179616 |
UniProt ID : | P55895 |
Products Types
◆ Recombinant Protein | ||
RAG2-7401M | Recombinant Mouse RAG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RAG2-2162H | Recombinant Human RAG2, GST-tagged | +Inquiry |
RAG2-8961Z | Recombinant Zebrafish RAG2 | +Inquiry |
RAG2-29371TH | Recombinant Human RAG2 | +Inquiry |
RAG2-13890M | Recombinant Mouse RAG2 Protein | +Inquiry |
◆ Lysates | ||
RAG2-2547HCL | Recombinant Human RAG2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All RAG2 Products
Required fields are marked with *
My Review for All RAG2 Products
Required fields are marked with *
0
Inquiry Basket