Recombinant Human ACTL6B, His-tagged

• Cat.No.: ACTL6B-26300TH
• Product Overview: Recombinant fragment, corresponding to amino acids 5-282 of Human BAF53b with an N terminal His tag. Predicted mwt: 32 kDa

Specification

• Description: The protein encoded by this gene is a member of a family of actin-related proteins (ARPs) which share significant amino acid sequence identity to conventional actins. Both actins and ARPs have an actin fold, which is an ATP-binding cleft, as a common feature. The ARPs are involved in diverse cellular processes, including vesicular transport, spindle orientation, nuclear migration and chromatin remodeling. This gene encodes a subunit of the BAF (BRG1/brm-associated factor) complex in mammals, which is functionally related to SWI/SNF complex in S. cerevisiae and Drosophila; the latter is thought to facilitate transcriptional activation of specific genes by antagonizing chromatin-mediated transcriptional repression. This subunit may be involved in the regulation of genes by structural modulation of their chromatin, specifically in the brain.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 90 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: VYGGDEVGALVFDIGSFSVRAGYAGEDCPKADFPTTVGLL AAEEGGGLELEGDKEKKGKIFHIDTNALHVPRDGAEVM SPLKNGMIEDWECFRAILDHTYSKHVKSEPNLHPVLMSEA PWNTRAKREKLTELMFEQYNIPAFFLCKTAVLTAFANG RSTGLVLDSGATHTTAIPVHDGYVLQQGIVKSPLAGDF ISMQCRELFQEMAIDIIPPYMIAAKEPVREGAPPNWKKKE KLPQVSKSWHNYMCNEVIQDFQASVLQVSDSPYDEQVA AQMPTV

Gene Information

• Gene Name: ACTL6B actin-like 6B [ Homo sapiens ]
• Official Symbol: ACTL6B
• Synonyms: ACTL6B; actin-like 6B; actin like 6 , ACTL6; actin-like protein 6B; BAF53B
• Gene ID: 51412
• mRNA Refseq: NM_016188
• Protein Refseq: NP_057272
• MIM: 612458
• Uniprot ID: O94805
• Chromosome Location: 7q22
• Function: ATP binding; structural constituent of cytoskeleton; transcription coactivator activity

Reviews

06/29/2020

Increased protein expression, enhanced cell proliferation, or inhibition of specific biological processes, when using this protein.

02/08/2020

The packaging includes proper labeling and documentation, facilitating easy identification and handling of the protein product upon arrival.

10/07/2019

They have provided valuable technical guidance and troubleshooting assistance, helping us optimize our experimental protocols and achieve better results.

01/08/2018

We have successfully replicated our findings using multiple batches of the protein product, indicating its reliable and consistent behavior.

01/28/2017

The protein product is produced using state-of-the-art manufacturing techniques, ensuring consistent quality and performance.

Q&As

Does ACTL6B have any known interacting partners outside the nBAF complex?

While the main known interacting partners of ACTL6B are within the nBAF complex, additional interactions with other proteins or complexes have not been extensively characterized.

Is ACTL6B involved in any developmental processes?

Yes, ACTL6B is implicated in neuronal development and differentiation, as it is required for proper chromatin remodeling during neuronal maturation.

What is the evolutionary conservation of ACTL6B?

ACTL6B is evolutionarily conserved across different species, indicating its functional importance throughout evolution.

Are there any alternative splicing variants of ACTL6B?

Alternative splicing variants of ACTL6B have not been widely reported in the literature. The majority of studies focus on the canonical isoform of ACTL6B.

Are there any known post-translational modifications of ACTL6B?

Specific post-translational modifications of ACTL6B, such as phosphorylation or acetylation, have not been extensively studied.

What is the role of ACTL6B in recessive autism spectrum disorder (ASD)?

ACTL6B loss is a significant cause of recessive ASD, suggesting its involvement in the development of this disorder.

What are the cellular functions of ACTL6B?

ACTL6B plays a role in chromatin remodeling, gene regulation, and transcriptional control in various cell types, particularly in postmitotic neurons.

Is ACTL6B structurally similar to other actin-like proteins?

Yes, ACTL6B shares structural similarities with other actin-like proteins, including the presence of an actin fold and conserved residues involved in protein-protein interactions.

What is the subcellular localization of ACTL6B?

ACTL6B is primarily localized in the nucleus, where it exerts its functions in chromatin remodeling and gene regulation.

What are the functional roles of ACTL6B in cells?

ACTL6B, as part of the nBAF complex, is involved in chromatin remodeling and gene regulation, particularly in postmitotic neurons. It plays a role in shaping the chromatin landscape and influencing cellular processes related to neuronal development and function.

What is the family of ACTL6B?

ACTL6B belongs to the actin-like protein family, which comprises proteins that share structural similarities with actin but may have distinct functions and roles in cellular processes.

Are there any known homologs or paralogs of ACTL6B?

Yes, ACTL6B has a paralog called ACTL6A (Actin-like 6A), which shares similarities in structure and function.

Are there any known genetic disorders associated with ACTL6B mutations?

Currently, there are no specific genetic disorders linked to ACTL6B mutations

How does the nBAF complex contribute to chromatin remodeling?

The nBAF complex, including ACTL6B, plays a role in modifying the structure of chromatin, allowing for proper gene regulation and functional changes in postmitotic neurons.

Which complex is ACTL6B a part of, and what is its function in neurons?

ACTL6B is a component of the neuronal BRG1/brm-associated factor (nBAF) complex, which is required for chromatin remodeling specifically in postmitotic neurons.

Can ACTL6B interact with other proteins or complexes?

Yes, ACTL6B interacts with other proteins within the neuronal BRG1/brm-associated factor (nBAF) complex, including various subunits involved in chromatin remodeling and gene regulation.

Does ACTL6B have any known interacting partners outside the nBAF complex?

While the main known interacting partners of ACTL6B are within the nBAF complex, additional interactions with other proteins or complexes have not been extensively characterized.

Are there potential implications for targeting ACTL6B or the nBAF complex in ASD treatment?

Targeting ACTL6B or the nBAF complex could hold therapeutic potential for ASD; however, further research is needed to understand the precise mechanisms involved and to evaluate the feasibility and effectiveness of such targeting approaches.

Is ACTL6B expressed in specific tissues or cell types?

ACTL6B is widely expressed in various tissues, but its expression is particularly prominent in the brain, where it plays a crucial role in neuronal development and function.

What is the proposed mechanism by which ACTL6B contributes to ASD?

Impaired neuron-specific chromatin repression is proposed as a potential mechanism underlying the association between ACTL6B loss and ASD.

What is the structure of ACTL6B?

ACTL6B belongs to the actin-like protein family and has a conserved structure similar to actin proteins. It consists of a globular domain and a flexible C-terminal tail.