Recombinant Human ADH5, His-tagged
Cat.No. : | ADH5-27095TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 111-374 of Human ADH5 with an N terminal His tag. Predicted mwt: 29 kDa; |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the alcohol dehydrogenase family. Members of this family metabolize a wide variety of substrates, including ethanol, retinol, other aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. The encoded protein forms a homodimer. It has virtually no activity for ethanol oxidation, but exhibits high activity for oxidation of long-chain primary alcohols and for oxidation of S-hydroxymethyl-glutathione, a spontaneous adduct between formaldehyde and glutathione. This enzyme is an important component of cellular metabolism for the elimination of formaldehyde, a potent irritant and sensitizing agent that causes lacrymation, rhinitis, pharyngitis, and contact dermatitis. The human genome contains several non-transcribed pseudogenes related to this gene. |
Conjugation : | HIS |
Source : | E. coli |
Form : | Lyophilised:Reconstitute with 105 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | CQKIRVTQGKGLMPDGTSRFTCKGKTILHYMGTSTFSEYT VVADISVAKIDPLAPLDKVCLLGCGISTGYGAAVNTAK LEPGSVCAVFGLGGVGLAVIMGCKVAGASRIIGVDINKDK FARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSF ECIGNVKVMRAALEACHKGWGVSVVVGVAASGEEIATR PFQLVTGRTWKGTAFGGWKSVESVPKLVSEYMSKKIKVDE FVTHNLSFDEINKAFELMHSGKSIRTVVKI |
Gene Name : | ADH5 alcohol dehydrogenase 5 (class III), chi polypeptide [ Homo sapiens ] |
Official Symbol : | ADH5 |
Synonyms : | ADH5; alcohol dehydrogenase 5 (class III), chi polypeptide; FDH, formaldehyde dehydrogenase; alcohol dehydrogenase class-3; ADH 3; ADHX; |
Gene ID : | 128 |
mRNA Refseq : | NM_000671 |
Protein Refseq : | NP_000662 |
MIM : | 103710 |
Uniprot ID : | P11766 |
Chromosome Location : | 4q23 |
Pathway : | Drug metabolism - cytochrome P450, organism-specific biosystem; Drug metabolism - cytochrome P450, conserved biosystem; Fatty acid metabolism, organism-specific biosystem; Fatty acid metabolism, conserved biosystem; Glycolysis / Gluconeogenesis, organism-specific biosystem; |
Function : | S-(hydroxymethyl)glutathione dehydrogenase activity; alcohol dehydrogenase (NAD) activity; electron carrier activity; fatty acid binding; formaldehyde dehydrogenase activity; |
Products Types
◆ Recombinant Protein | ||
ADH5-0256H | Recombinant Human ADH5 Protein (M1-I374), Tag Free | +Inquiry |
ADH5-0257H | Recombinant Human ADH5 Protein (M1-I374), GST tagged | +Inquiry |
ADH5-180R | Recombinant Rat ADH5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ADH5-1317H | Recombinant Human ADH5 Protein (2-374 aa), His-tagged | +Inquiry |
Adh5-543M | Recombinant Mouse Adh5 Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
ADH5-30HCL | Recombinant Human ADH5 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionADH5 exhibits a tissue-specific expression pattern, and its expression is regulated by various factors such as transcriptional control and signaling pathways.
ADH5 can efficiently metabolize different alcohol substrates, and its substrate specificity may differ from other ADH enzymes.
ADH5 expression and activity can be influenced by chronic alcohol exposure or withdrawal, and studying the underlying molecular mechanisms can shed light on alcohol-related effects.
The activity or function of ADH5 can potentially be modulated by pharmacological agents or environmental factors, presenting potential therapeutic implications.
Interacting proteins or cofactors can modulate the activity or function of ADH5, and investigating the molecular mechanisms involved can enhance our understanding of its regulation.
The enzymatic kinetics and catalytic properties of ADH5 contribute to its overall activity and efficiency in alcohol metabolism.
ADH5 may have implications in the metabolism of other endogenous compounds or xenobiotics, suggesting its involvement in broader physiological functions.
Genetic variations or polymorphisms in the ADH5 gene may impact alcohol metabolism and susceptibility to alcohol-related disorders, emphasizing the role of genetic factors in its function.
The structural features of ADH5 play a crucial role in its catalytic activity and binding affinity for alcohol, and understanding these features provides insights into its function.
Exploring the consequences of ADH5 deficiency or overexpression provides insights into its role in alcohol metabolism and its impact on physiological processes.
Customer Reviews (2)
Write a reviewHighly effective in stabilizing and enhancing the activity of enzymes in enzyme engineering.
Demonstrates excellent resistance to aggregation and aggregation-prone conditions.
Ask a Question for All ADH5 Products
Required fields are marked with *
My Review for All ADH5 Products
Required fields are marked with *
Inquiry Basket