Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human AGTR2 protein, His/SUMO-tagged

Cat.No. : AGTR2-33H
Product Overview : Recombinant Human AGTR2(1-45aa) fused with His/SUMO tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation.
Source : E. coli
Species : Human
Tag : His/SUMO
Form : 20mM Tris-HCl based buffer,pH8.0
Protein length : 1-45aa
AA Sequence : MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD
Purity : Greater than 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigradefor up to one week.
Gene Name : AGTR2 angiotensin II receptor, type 2 [ Homo sapiens ]
Official Symbol : AGTR2
Synonyms : AGTR2; angiotensin II receptor, type 2; angiotensin receptor 2; type-2 angiotensin II receptor; AT2; MRX88; angiotensin II type-2 receptor; ATGR2;
Gene ID : 186
mRNA Refseq : NM_000686
Protein Refseq : NP_000677
MIM : 300034
UniProt ID : P50052
Chromosome Location : Xq22-q23
Pathway : ACE Inhibitor Pathway, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem;
Function : G-protein coupled receptor activity; angiotensin type II receptor activity; protein binding; receptor activity; receptor antagonist activity; signal transducer activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (10)

Ask a question
Are there any epigenetic modifications associated with AGTR2 expression? 05/08/2022

Epigenetic modifications, such as DNA methylation and histone acetylation, have been implicated in regulating AGTR2 expression. Hypermethylation of the AGTR2 gene promoter has been observed in certain pathological conditions, suggesting a potential mechanism for altered AGTR2 expression and associated diseases.

How does AGTR2 impact cardiac remodeling after myocardial infarction? 09/24/2021

AGTR2 activation can exert anti-fibrotic and anti-hypertrophic effects in the heart after myocardial infarction. AGTR2 activation promotes cardiomyocyte survival, limits adverse remodeling, and improves cardiac function, indicating its therapeutic potential in post-MI cardiac remodeling.

How does AGTR2 interact with other signaling pathways? 09/08/2021

AGTR2 can cross-talk with other receptors and signaling pathways, such as the insulin-like growth factor 1 receptor and the Wnt/β-catenin pathway, to regulate cellular processes.

How is AGTR2 regulated at the transcriptional level? 05/20/2021

Several transcription factors, including Sp1, AP-1, and NF-κB, can bind to the promoter region of AGTR2 and modulate its gene expression.

How is AGTR2 involved in cancer biology? 04/02/2020

AGTR2 may have dual roles in cancer progression, acting as a tumor suppressor or a promoter depending on the specific cancer type.

What post-translational modifications are known to regulate AGTR2 activity? 02/19/2020

Phosphorylation, ubiquitination, and glycosylation are among the post-translational modifications that can modulate AGTR2 function and signaling.

Are there any genetic polymorphisms associated with AGTR2? 02/03/2020

Yes, certain genetic variations in AGTR2 have been linked to various diseases, including hypertension, preeclampsia, and neurological disorders.

What are the downstream signaling pathways activated by AGTR2? 09/01/2019

AGTR2 can activate multiple signaling pathways, including phosphatases, kinases, and nitric oxide synthase.

What are the tissue-specific expression patterns of AGTR2? 01/14/2019

AGTR2 is expressed in various tissues, including the cardiovascular system, brain, kidney, and reproductive organs.

What is the role of AGTR2 in the cardiovascular system? 07/07/2018

AGTR2 has been implicated in cardiovascular development, blood pressure regulation, and vascular remodeling.

Customer Reviews (5)

Write a review
Reviews
03/12/2022

    It worked seamlessly in my experiments, yielding consistent and reliable results.

    06/25/2021

      The protein I purchased exceeded my expectations. It was highly pure and performed exceptionally well in my protein-protein interaction studies.

      02/14/2020

        I highly recommend this product. It saved me a significant amount of time and effort in my research, delivering excellent performance.

        09/08/2019

          It was easy to use, and the results were reproducible, giving me confidence in my data.

          11/30/2018

            Exceptional protein. Worth every penny.

            Ask a Question for All AGTR2 Products

            Required fields are marked with *

            My Review for All AGTR2 Products

            Required fields are marked with *

            0

            Inquiry Basket

            cartIcon
            logo

            FOLLOW US

            Terms and Conditions        Privacy Policy

            Copyright © 2024 Creative BioMart. All Rights Reserved.

            Contact Us

            • /

            Stay Updated on the Latest Bioscience Trends