Recombinant Human AGTR2 protein, His/SUMO-tagged
Cat.No. : | AGTR2-33H |
Product Overview : | Recombinant Human AGTR2(1-45aa) fused with His/SUMO tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene belongs to the G-protein coupled receptor 1 family, and functions as a receptor for angiotensin II. It is an intergral membrane protein that is highly expressed in fetus, but scantily in adult tissues, except brain, adrenal medulla, and atretic ovary. This receptor has been shown to mediate programmed cell death and this apoptotic function may play an important role in developmental biology and pathophysiology. Mutations in this gene are been associated with X-linked mental retardation. |
Source : | E. coli |
Species : | Human |
Tag : | His/SUMO |
Form : | 20mM Tris-HCl based buffer,pH8.0 |
Protein length : | 1-45aa |
AA Sequence : | MKGNSTLATTSKNITSGLHFGLVNISGNNESTLNCSQKPSDKHLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigradefor up to one week. |
Gene Name : | AGTR2 angiotensin II receptor, type 2 [ Homo sapiens ] |
Official Symbol : | AGTR2 |
Synonyms : | AGTR2; angiotensin II receptor, type 2; angiotensin receptor 2; type-2 angiotensin II receptor; AT2; MRX88; angiotensin II type-2 receptor; ATGR2; |
Gene ID : | 186 |
mRNA Refseq : | NM_000686 |
Protein Refseq : | NP_000677 |
MIM : | 300034 |
UniProt ID : | P50052 |
Chromosome Location : | Xq22-q23 |
Pathway : | ACE Inhibitor Pathway, organism-specific biosystem; Class A/1 (Rhodopsin-like receptors), organism-specific biosystem; G alpha (i) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; GPCR ligand binding, organism-specific biosystem; GPCRs, Class A Rhodopsin-like, organism-specific biosystem; Neuroactive ligand-receptor interaction, organism-specific biosystem; |
Function : | G-protein coupled receptor activity; angiotensin type II receptor activity; protein binding; receptor activity; receptor antagonist activity; signal transducer activity; |
Products Types
◆ Recombinant Protein | ||
AGTR2-313R | Recombinant Rat AGTR2 Protein (1-45 aa), GST-tagged | +Inquiry |
AGTR2-2445H | Recombinant Human AGTR2 Protein, His (Fc)-Avi-tagged | +Inquiry |
AGTR2-1321R | Recombinant Rat AGTR2 Protein (1-45 aa), His-tagged | +Inquiry |
AGTR2-397H | Recombinant Human AGTR2 | +Inquiry |
AGTR2-1058HFL | Recombinant Human AGTR2 protein, His&Flag-tagged | +Inquiry |
◆ Lysates | ||
AGTR2-8969HCL | Recombinant Human AGTR2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionEpigenetic modifications, such as DNA methylation and histone acetylation, have been implicated in regulating AGTR2 expression. Hypermethylation of the AGTR2 gene promoter has been observed in certain pathological conditions, suggesting a potential mechanism for altered AGTR2 expression and associated diseases.
AGTR2 activation can exert anti-fibrotic and anti-hypertrophic effects in the heart after myocardial infarction. AGTR2 activation promotes cardiomyocyte survival, limits adverse remodeling, and improves cardiac function, indicating its therapeutic potential in post-MI cardiac remodeling.
AGTR2 can cross-talk with other receptors and signaling pathways, such as the insulin-like growth factor 1 receptor and the Wnt/β-catenin pathway, to regulate cellular processes.
Several transcription factors, including Sp1, AP-1, and NF-κB, can bind to the promoter region of AGTR2 and modulate its gene expression.
AGTR2 may have dual roles in cancer progression, acting as a tumor suppressor or a promoter depending on the specific cancer type.
Phosphorylation, ubiquitination, and glycosylation are among the post-translational modifications that can modulate AGTR2 function and signaling.
Yes, certain genetic variations in AGTR2 have been linked to various diseases, including hypertension, preeclampsia, and neurological disorders.
AGTR2 can activate multiple signaling pathways, including phosphatases, kinases, and nitric oxide synthase.
AGTR2 is expressed in various tissues, including the cardiovascular system, brain, kidney, and reproductive organs.
AGTR2 has been implicated in cardiovascular development, blood pressure regulation, and vascular remodeling.
Customer Reviews (5)
Write a reviewIt worked seamlessly in my experiments, yielding consistent and reliable results.
The protein I purchased exceeded my expectations. It was highly pure and performed exceptionally well in my protein-protein interaction studies.
I highly recommend this product. It saved me a significant amount of time and effort in my research, delivering excellent performance.
It was easy to use, and the results were reproducible, giving me confidence in my data.
Exceptional protein. Worth every penny.
Ask a Question for All AGTR2 Products
Required fields are marked with *
My Review for All AGTR2 Products
Required fields are marked with *
Inquiry Basket