Recombinant Human AKAP9, His-tagged
Cat.No. : | AKAP9-26527TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 3496-3773 of Human AKAP9 with N terminal His tag; 278 amino acids, 32kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternate splicing of this gene results in at least two isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways. These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, protein phosphatase 2a, protein kinase C-epsilon and phosphodiesterase 4D3. |
Conjugation : | HIS |
Source : | E. coli |
Tissue specificity : | Widely expressed. Isoform 4 is highly expressed in skeletal muscle and in pancreas. |
Form : | Lyophilised:Reconstitute with 82 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | GGTGCNHELEMIRQKLQCVASKLQVLPQKASERLQFETAD DEDFIWVQENIDEIILQLQKLTGQQGEEPSLVSPSTSC GSLTERLLRQNAELTGHISQLTEEKNDLRNMVMKLEEQIR WYRQTGAGRDNSSRFSLNGGANIEAIIASEKEVWNREK LTLQKSLKRAEAEVYKLKAELRNDSLLQTLSPDSEHVT LKRIYGKYLRAESFRKALIYQKKYLLLLLGGFQECEDATL ALLARMGGQPAFTDLEVITNRPKGFTRFRSAVRVSIAI SRMKFL |
Gene Name : | AKAP9 A kinase (PRKA) anchor protein (yotiao) 9 [ Homo sapiens ] |
Official Symbol : | AKAP9 |
Synonyms : | AKAP9; A kinase (PRKA) anchor protein (yotiao) 9; A-kinase anchor protein 9; A kinase anchor protein; 350kDa; A kinase anchoring protein 450; AKAP9 BRAF fusion protein; AKAP120 like protein; AKAP350; AKAP450; centrosome and golgi localized protein; CG NA |
Gene ID : | 10142 |
mRNA Refseq : | NM_005751 |
Protein Refseq : | NP_005742 |
MIM : | 604001 |
Uniprot ID : | Q99996 |
Chromosome Location : | 7q21-q22 |
Pathway : | Activation of NMDA receptor upon glutamate binding and postsynaptic events, organism-specific biosystem; CREB phosphorylation through the activation of CaMKII, organism-specific biosystem; CREB phosphorylation through the activation of Ras, organism-specific biosystem; Cell Cycle, Mitotic, organism-specific biosystem; Centrosome maturation, organism-specific biosystem; |
Function : | kinase activity; protein binding; receptor binding; |
Products Types
◆ Recombinant Protein | ||
AKAP9-405H | Recombinant Human AKAP9 Protein, GST-tagged | +Inquiry |
AKAP9-7119C | Recombinant Chicken AKAP9 | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (17)
Ask a questionAKAP9 plays essential roles in cardiac development and function. It is involved in the assembly and organization of the contractile machinery in cardiomyocytes, regulation of calcium signaling, modulation of cardiac gene expression, and maintenance of proper cardiac structure. Mutations in AKAP9 have been associated with dilated cardiomyopathy and other heart-related disorders.
Yes, AKAP9 has been implicated in neurodevelopment and neuronal function. It is expressed in the developing brain and is involved in neuronal migration, axon guidance, and synapse formation. Mutations in AKAP9 have been linked to intellectual disability and neurodevelopmental disorders.
Yes, AKAP9 has been implicated in cell motility and migration. It interacts with components of the cytoskeleton, such as microtubules and myosin, to regulate cell shape, adhesion, and movement. The precise mechanisms through which AKAP9 modulates cell motility are still being investigated.
Mutations in the AKAP9 gene have been linked to various genetic disorders, such as long QT syndrome, dilated cardiomyopathy, intellectual disability, and other developmental and neurological conditions.
The expression of AKAP9 can be regulated at the transcriptional level by various factors, including transcription factors, epigenetic modifications, and signaling pathways. Additionally, post-translational modifications, such as phosphorylation, can also modulate the activity and localization of AKAP9 protein.
AKAP9 protein has been implicated in certain types of cancer. For example, alterations in AKAP9 expression have been observed in ovarian, colorectal, and breast cancer, suggesting its potential involvement in tumorigenesis. However, more research is needed to fully understand its role in cancer development and progression.
Given its involvement in cardiac function and disease, AKAP9 is a potential therapeutic target for cardiovascular disorders. However, developing specific interventions that can effectively modulate AKAP9 activity or interactions while maintaining overall cellular homeostasis remains a significant challenge and requires further research.
Currently, there are no known drugs or compounds specifically targeting AKAP9. However, research efforts are ongoing to identify small molecules or peptides that can selectively modulate the activity or interactions of AKAP9 for potential therapeutic applications.
AKAP9 protein contains several functional domains, including spectrin repeats, ankyrin repeats, and a kinase-binding domain (KBD). These domains enable AKAP9 to interact with different signaling molecules and facilitate its diverse functions.
AKAP9 has been proposed as a potential biomarker in certain diseases, such as heart failure. Increased AKAP9 expression has been associated with poor prognosis in heart failure patients. However, further studies are needed to validate its potential as a biomarker in different clinical settings.
AKAP9 protein interacts with numerous proteins, including protein kinase A (PKA), protein kinase C (PKC), protein phosphatase 2B (PP2B), microtubules, myosin, and various transcription factors.
Yes, animal models, such as mice, have been used to study the impact of AKAP9 mutations or knockout on disease phenotypes. These models can help researchers understand the underlying mechanisms, evaluate therapeutic interventions, and assess the consequences of AKAP9 dysfunction in vivo.
AKAP9 is being investigated in cancer research to understand its potential roles in tumorigenesis, metastasis, and response to therapy. Alterations in AKAP9 expression and function have been associated with various cancers, and further studies aim to elucidate the underlying mechanisms and explore its therapeutic implications in cancer treatment.
Yes, studies have reported that certain AKAP9 mutations can lead to embryonic lethality in animal models. These mutations can disrupt critical developmental processes, such as heart development or neuronal migration, resulting in severe developmental defects and embryo death.
Due to its crucial role in cellular signaling and its association with certain diseases, AKAP9 has the potential to be a therapeutic target. However, specific drugs or interventions targeting AKAP9 have not yet been developed, and further research is needed to explore this possibility.
Studying AKAP9 protein can provide insights into the spatial and temporal organization of cellular signaling networks. AKAP9 acts as a scaffold protein, bringing together different signaling molecules and enzymes to facilitate their interactions and regulate downstream signaling events. Understanding the specific interactions and functions of AKAP9 can contribute to elucidating the complexity and dynamics of cellular signaling pathways.
AKAP9 is involved in multiple cellular processes, including regulation of cell division and mitotic spindle assembly, cell migration and adhesion, calcium signaling, cAMP-PKA signaling, and gene transcription.
Customer Reviews (4)
Write a reviewThe AKAP9 protein demonstrates an exceptional level of quality that surpasses expectations, making it the perfect fit for my experimental requirements.
With their unwavering guidance and expertise, I am assured that I will receive the necessary support to overcome any hurdles, enabling seamless progress in my research.
The AKAP9 protein's remarkable attributes ensure that it will not only meet but exceed my experimental needs.
With its superior purity and consistent performance, this protein guarantees reliable and accurate results, aligning impeccably with my research objectives.
Ask a Question for All AKAP9 Products
Required fields are marked with *
My Review for All AKAP9 Products
Required fields are marked with *
Inquiry Basket