Recombinant Human APBB1
Cat.No. : | APBB1-28167TH |
Product Overview : | Recombinant full length Human FE65 with N terminal proprietary tag; Predicted MWt 103.95 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimers disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene products nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimers disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants have been described for this gene but some of their full length sequence is not known. |
Protein length : | 708 amino acids |
Molecular Weight : | 103.950kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Highly expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKL QATAVGPKDLRSAMGEGGGPEPGPANAKWLKEGQNQLRRA ATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSEL ELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAAGEAEEE EEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPR EHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQW EPPGRASPSQGSSPQEESQLTWTGFAHGEGFEDGEFWKDE PSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPP RNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQ LSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQA LLHAQPIISIRVWGVGRDSGRDFAYVARDKLTQMLKCHVF RCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSK LVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVDVI NGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLG ECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPN AASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVA RRVGWTVRRGVQSLWGSLKPKRLGAHTP |
Sequence Similarities : | Contains 2 PID domains.Contains 1 WW domain. |
Gene Name : | APBB1 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) [ Homo sapiens ] |
Official Symbol : | APBB1 |
Synonyms : | APBB1; amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65); RIR; amyloid beta A4 precursor protein-binding family B member 1; Fe65; |
Gene ID : | 322 |
mRNA Refseq : | NM_001164 |
Protein Refseq : | NP_001155 |
MIM : | 602709 |
Uniprot ID : | O00213 |
Chromosome Location : | 11p15 |
Pathway : | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; |
Function : | beta-amyloid binding; beta-amyloid binding; chromatin binding; histone binding; proline-rich region binding; |
Products Types
◆ Recombinant Protein | ||
Apbb1-199M | Recombinant Mouse Apbb1 Protein, His-tagged | +Inquiry |
APBB1-615M | Recombinant Mouse APBB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Apbb1-622M | Recombinant Mouse Apbb1 Protein, MYC/DDK-tagged | +Inquiry |
APBB1-366R | Recombinant Rat APBB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
APBB1-1655H | Recombinant Human APBB1 protein, His & T7-tagged | +Inquiry |
◆ Lysates | ||
APBB1-8803HCL | Recombinant Human APBB1 293 Cell Lysate | +Inquiry |
APBB1-8804HCL | Recombinant Human APBB1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (19)
Ask a questionAPBB1 are involved in mitochondrial and Wnt signaling pathways.
Recombinant APBB1 protein is a transcription factor associated with biological processes such as protein breakdown, signaling, and the cell cycle. Its main function is to participate in the regulation of transcription and RNA stability.
Mutations in the APBB1 gene are thought to be a risk gene for certain cancers and diseases such as Alzheimer's disease.
The APBB1 gene is known to have multiple tailoring exons. In humans, there may be variable splicing of APBB1 gene.
There are currently no drugs on the market that target the APBB1. At the same time, some researchers are exploring molecules related to APBB1 to develop drugs to treat diseases associated with it.
APBB1 is involved in regulating the metabolism and transport of Alzheimer's disease-associated Aβ peptides and may be a therapeutic target for Alzheimer's disease.
The APBB1 has been studied in relation to many diseases, including Alzheimer's disease, cancer and cardiovascular disease.
APBB1 is highly expressed in tissues such as brain, heart and lung.
Variations in both the APBB1 gene and the APP gene are considered risk genes for Alzheimer's disease.
APBB1 is associated with the amyloid precursor protein metabolic pathway (APP).
The use of gene editing technology to study APBB1 to treat and prevent related diseases is a research hotspot in recent years.
APBB1 has been shown to be involved in a number of cell cycle and apoptosis pathways, so it may hold promise as a new target for cancer therapy.
There are currently no specific antibodies available for the detection of APBB1 .
Mutations in the APBB1 gene are thought to be associated with diseases such as cancer and Alzheimer's disease.
APBB1 is involved in signaling pathways in the occurrence and development of cardiovascular diseases such as myocardial hypertrophy and myocardial fibrosis.
APBB1 may be involved in the regulation of apoptosis.
APBB1 protein may act as a tumor inhibitor and participate in the regulation of cell cycle progression and apoptosis.
It has been shown that the impairment of cognitive function associated with Alzheimer's disease can be mitigated by regulating the APBB1.
At present, there are no studies to prove the mechanism of APBB1 promoting cardiovascular organ regeneration.
Customer Reviews (4)
Write a reviewAPBB1 they produce has strong anti-pollution ability and is safe to use.
Band position of APBB1 in Western blot was consistent with the expectation, showing good target recognition ability.
Catalytic activity of APBB1 is very strong, which can significantly improve the yield of chemical reactions and reduce costs, and its economic value is outstanding.
After using this APBB1, my experiment repeatability is very good, which is convenient for subsequent data analysis and experimental operation.
Ask a Question for All APBB1 Products
Required fields are marked with *
My Review for All APBB1 Products
Required fields are marked with *
Inquiry Basket