Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human APBB1

Cat.No. : APBB1-28167TH
Product Overview : Recombinant full length Human FE65 with N terminal proprietary tag; Predicted MWt 103.95 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene is a member of the Fe65 protein family. It is an adaptor protein localized in the nucleus. It interacts with the Alzheimers disease amyloid precursor protein (APP), transcription factor CP2/LSF/LBP1 and the low-density lipoprotein receptor-related protein. APP functions as a cytosolic anchoring site that can prevent the gene products nuclear translocation. This encoded protein could play an important role in the pathogenesis of Alzheimers disease. It is thought to regulate transcription. Also it is observed to block cell cycle progression by downregulating thymidylate synthase expression. Multiple alternatively spliced transcript variants have been described for this gene but some of their full length sequence is not known.
Protein length : 708 amino acids
Molecular Weight : 103.950kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Highly expressed in brain; strongly reduced in post-mortem elderly subjects with Alzheimer disease.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MSVPSSLSQSAINANSHGGPALSLPLPLHAAHNQLLNAKL QATAVGPKDLRSAMGEGGGPEPGPANAKWLKEGQNQLRRA ATAHRDQNRNVTLTLAEEASQEPEMAPLGPKGLIHLYSEL ELSAHNAANRGLRGPGLIISTQEQGPDEGEEKAAGEAEEE EEDDDDEEEEEDLSSPPGLPEPLESVEAPPRPQALTDGPR EHSKSASLLFGMRNSAASDEDSSWATLSQGSPSYGSPEDT DSFWNPNAFETDSDLPAGWMRVQDTSGTYYWHIPTGTTQW EPPGRASPSQGSSPQEESQLTWTGFAHGEGFEDGEFWKDE PSDEAPMELGLKEPEEGTLTFPAQSLSPEPLPQEEEKLPP RNTNPGIKCFAVRSLGWVEMTEEELAPGRSSVAVNNCIRQ LSYHKNNLHDPMSGGWGEGKDLLLQLEDETLKLVEPQSQA LLHAQPIISIRVWGVGRDSGRDFAYVARDKLTQMLKCHVF RCEAPAKNIATSLHEICSKIMAERRNARCLVNGLSLDHSK LVDVPFQVEFPAPKNELVQKFQVYYLGNVPVAKPVGVDVI NGALESVLSSSSREQWTPSHVSVAPATLTILHQQTEAVLG ECRVRFLSFLAVGRDVHTFAFIMAAGPASFCCHMFWCEPN AASLSEAVQAACMLRYQKCLDARSQASTSCLPAPPAESVA RRVGWTVRRGVQSLWGSLKPKRLGAHTP
Sequence Similarities : Contains 2 PID domains.Contains 1 WW domain.
Gene Name : APBB1 amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) [ Homo sapiens ]
Official Symbol : APBB1
Synonyms : APBB1; amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65); RIR; amyloid beta A4 precursor protein-binding family B member 1; Fe65;
Gene ID : 322
mRNA Refseq : NM_001164
Protein Refseq : NP_001155
MIM : 602709
Uniprot ID : O00213
Chromosome Location : 11p15
Pathway : Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem;
Function : beta-amyloid binding; beta-amyloid binding; chromatin binding; histone binding; proline-rich region binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (19)

Ask a question
Does APBB1 involve signal transduction pathways? 11/24/2022

APBB1 are involved in mitochondrial and Wnt signaling pathways.

What is the function and mechanism of APBB1 ? 11/23/2022

Recombinant APBB1 protein is a transcription factor associated with biological processes such as protein breakdown, signaling, and the cell cycle. Its main function is to participate in the regulation of transcription and RNA stability.

Is the APBB1 gene associated with genetic susceptibility to cancer? 07/31/2022

Mutations in the APBB1 gene are thought to be a risk gene for certain cancers and diseases such as Alzheimer's disease.

Is there gene tailoring of APBB1 in humans? If so, what is their molecular phenotype? 04/23/2022

The APBB1 gene is known to have multiple tailoring exons. In humans, there may be variable splicing of APBB1 gene.

Are there any drugs that target APBB1 ? If so, what is their mechanism of action? 04/01/2022

There are currently no drugs on the market that target the APBB1. At the same time, some researchers are exploring molecules related to APBB1 to develop drugs to treat diseases associated with it.

What is the mechanism of action of APBB1 in the treatment of Alzheimer's disease? 01/19/2022

APBB1 is involved in regulating the metabolism and transport of Alzheimer's disease-associated Aβ peptides and may be a therapeutic target for Alzheimer's disease.

In what diseases does recombinant APBB1 play an important role? 11/15/2021

The APBB1 has been studied in relation to many diseases, including Alzheimer's disease, cancer and cardiovascular disease.

In which organs is the expression of APBB1 high? 10/17/2021

APBB1 is highly expressed in tissues such as brain, heart and lung.

Has any study confirmed the correlation between APBB1 and the mutation of the gene encoding APP? 09/10/2021

Variations in both the APBB1 gene and the APP gene are considered risk genes for Alzheimer's disease.

What are the biological pathways associated with APBB1 ? 08/24/2021

APBB1 is associated with the amyloid precursor protein metabolic pathway (APP).

Is there any modern technology that can achieve the effect of treating and preventing related diseases by gene editing APBB1? 11/25/2020

The use of gene editing technology to study APBB1 to treat and prevent related diseases is a research hotspot in recent years.

Is there any research to prove that APBB1 can play an important role in anticancer therapy? 10/19/2020

APBB1 has been shown to be involved in a number of cell cycle and apoptosis pathways, so it may hold promise as a new target for cancer therapy.

Is there a specific antibody that can be used to detect APBB1 ? 09/21/2020

There are currently no specific antibodies available for the detection of APBB1 .

Are there any diseases associated with APBB1 gene mutation? If so, what are they? 12/21/2019

Mutations in the APBB1 gene are thought to be associated with diseases such as cancer and Alzheimer's disease.

What is the mechanism of action of APBB1 in cardiovascular disease? 09/08/2019

APBB1 is involved in signaling pathways in the occurrence and development of cardiovascular diseases such as myocardial hypertrophy and myocardial fibrosis.

Is APBB1 related to apoptosis? If so, what are their mechanisms? 06/28/2019

APBB1 may be involved in the regulation of apoptosis.

What is the role of APBB1 in tumor growth? 06/19/2019

APBB1 protein may act as a tumor inhibitor and participate in the regulation of cell cycle progression and apoptosis.

Are there any studies to control dementia symptoms associated with Alzheimer's disease by regulating the recombinant APBB1 protein? 04/15/2019

It has been shown that the impairment of cognitive function associated with Alzheimer's disease can be mitigated by regulating the APBB1.

Is there any research to prove that APBB1 can promote the regeneration of cardiovascular organs? 03/29/2019

At present, there are no studies to prove the mechanism of APBB1 promoting cardiovascular organ regeneration.

Customer Reviews (4)

Write a review
Reviews
12/08/2021

    APBB1 they produce has strong anti-pollution ability and is safe to use.

    02/21/2020

      Band position of APBB1 in Western blot was consistent with the expectation, showing good target recognition ability.

      12/14/2019

        Catalytic activity of APBB1 is very strong, which can significantly improve the yield of chemical reactions and reduce costs, and its economic value is outstanding.

        08/03/2019

          After using this APBB1, my experiment repeatability is very good, which is convenient for subsequent data analysis and experimental operation.

          Ask a Question for All APBB1 Products

          Required fields are marked with *

          My Review for All APBB1 Products

          Required fields are marked with *

          0

          Inquiry Basket

          cartIcon
          logo

          FOLLOW US

          Terms and Conditions        Privacy Policy

          Copyright © 2024 Creative BioMart. All Rights Reserved.

          Contact Us

          • /

          Stay Updated on the Latest Bioscience Trends