Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ARSA

Cat.No. : ARSA-26265TH
Product Overview : Recombinant fragment of Human ARSA with N terminal proprietary tag, 37.73 kDa. Predicted MW 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Alternatively spliced transcript variants have been described for this gene.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : FFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGE NYNLLGGVAGATPEVQQALKQLQLLKAQLDAAVTFGPSQV ARGEDPALQICCHPGCTPRPACCHCPDPHA
Sequence Similarities : Belongs to the sulfatase family.
Gene Name : ARSA arylsulfatase A [ Homo sapiens ]
Official Symbol : ARSA
Synonyms : ARSA; arylsulfatase A; metachromatic leucodystrophy;
Gene ID : 410
mRNA Refseq : NM_000487
Protein Refseq : NP_000478
MIM : 607574
Uniprot ID : P15289
Chromosome Location : 22q13.31-qter
Pathway : Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem;
Function : arylsulfatase activity; calcium ion binding; cerebroside-sulfatase activity; hydrolase activity; sulfuric ester hydrolase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (4)

Ask a question
Are there any known genetic variations in the ARSA gene? 06/25/2022

Yes, several genetic variations, including point mutations, deletions, and insertions, have been identified in the ARSA gene. These variations can lead to reduced ARSA activity and are responsible for different types and severities of metachromatic leukodystrophy.

Can ARSA deficiency be treated? 11/21/2018

At present, there is no cure for metachromatic leukodystrophy caused by ARSA deficiency. However, there are some treatments available that aim to manage the symptoms and slow disease progression, such as enzyme replacement therapy and hematopoietic stem cell transplantation. Research is ongoing to develop more effective therapeutic strategies for this condition.

What happens if ARSA is deficient? 12/01/2016

Deficiency of ARSA activity results in the accumulation of sulfatides within cells, particularly in the central and peripheral nervous systems. This buildup leads to the destruction of myelin, impairing nerve signal transmission and causing the symptoms associated with metachromatic leukodystrophy (MLD), such as motor and cognitive deterioration.

Is ARSA protein associated with any other diseases besides metachromatic leukodystrophy? 03/13/2016

Yes, in addition to MLD, alterations in ARSA activity have been implicated in certain types of multiple sclerosis (MS). Although the exact relationship is not fully understood, it is believed that decreased ARSA function may contribute to the pathogenesis of certain forms of MS.

Customer Reviews (3)

Write a review
Reviews
12/20/2021

    By utilizing the ARSA protein, I can approach my research with unwavering confidence in its quality, along with the unparalleled support provided by its manufacturer.

    03/05/2020

      I am genuinely excited to embark on this scientific journey, empowered by the superior ARSA protein and the manufacturer's unwavering commitment to ensuring my success.

      10/01/2017

        The ARSA protein comes highly recommended due to its exceptional performance in ELISA assays.

        Ask a Question for All ARSA Products

        Required fields are marked with *

        My Review for All ARSA Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends