Recombinant Human ARSA
Cat.No. : | ARSA-26265TH |
Product Overview : | Recombinant fragment of Human ARSA with N terminal proprietary tag, 37.73 kDa. Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene hydrolyzes cerebroside sulfate to cerebroside and sulfate. Defects in this gene lead to metachromatic leucodystrophy (MLD), a progressive demyelination disease which results in a variety of neurological symptoms and ultimately death. Alternatively spliced transcript variants have been described for this gene. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FFTQGSAHSDTTADPACHASSSLTAHEPPLLYDLSKDPGE NYNLLGGVAGATPEVQQALKQLQLLKAQLDAAVTFGPSQV ARGEDPALQICCHPGCTPRPACCHCPDPHA |
Sequence Similarities : | Belongs to the sulfatase family. |
Gene Name : | ARSA arylsulfatase A [ Homo sapiens ] |
Official Symbol : | ARSA |
Synonyms : | ARSA; arylsulfatase A; metachromatic leucodystrophy; |
Gene ID : | 410 |
mRNA Refseq : | NM_000487 |
Protein Refseq : | NP_000478 |
MIM : | 607574 |
Uniprot ID : | P15289 |
Chromosome Location : | 22q13.31-qter |
Pathway : | Lysosome, organism-specific biosystem; Lysosome, conserved biosystem; Sphingolipid metabolism, organism-specific biosystem; Sphingolipid metabolism, conserved biosystem; |
Function : | arylsulfatase activity; calcium ion binding; cerebroside-sulfatase activity; hydrolase activity; sulfuric ester hydrolase activity; |
Products Types
◆ Recombinant Protein | ||
ARSA-14H | Active Recombinant Human ARSA Protein (21-509), C-His-tagged | +Inquiry |
Arsa-654M | Recombinant Mouse Arsa Protein, MYC/DDK-tagged | +Inquiry |
ARSA-533H | Recombinant Human ARSA Protein, His-tagged | +Inquiry |
ARSA-2826H | Recombinant Human ARSA Protein, MYC/DDK-tagged | +Inquiry |
Arsa-2334M | Recombinant Mouse ARSA protein(Met1-Ser506), His-tagged | +Inquiry |
◆ Lysates | ||
ARSA-3086HCL | Recombinant Human ARSA cell lysate | +Inquiry |
ARSA-3085MCL | Recombinant Mouse ARSA cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (4)
Ask a questionYes, several genetic variations, including point mutations, deletions, and insertions, have been identified in the ARSA gene. These variations can lead to reduced ARSA activity and are responsible for different types and severities of metachromatic leukodystrophy.
At present, there is no cure for metachromatic leukodystrophy caused by ARSA deficiency. However, there are some treatments available that aim to manage the symptoms and slow disease progression, such as enzyme replacement therapy and hematopoietic stem cell transplantation. Research is ongoing to develop more effective therapeutic strategies for this condition.
Deficiency of ARSA activity results in the accumulation of sulfatides within cells, particularly in the central and peripheral nervous systems. This buildup leads to the destruction of myelin, impairing nerve signal transmission and causing the symptoms associated with metachromatic leukodystrophy (MLD), such as motor and cognitive deterioration.
Yes, in addition to MLD, alterations in ARSA activity have been implicated in certain types of multiple sclerosis (MS). Although the exact relationship is not fully understood, it is believed that decreased ARSA function may contribute to the pathogenesis of certain forms of MS.
Customer Reviews (3)
Write a reviewBy utilizing the ARSA protein, I can approach my research with unwavering confidence in its quality, along with the unparalleled support provided by its manufacturer.
I am genuinely excited to embark on this scientific journey, empowered by the superior ARSA protein and the manufacturer's unwavering commitment to ensuring my success.
The ARSA protein comes highly recommended due to its exceptional performance in ELISA assays.
Ask a Question for All ARSA Products
Required fields are marked with *
My Review for All ARSA Products
Required fields are marked with *
Inquiry Basket