Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ATP2A3

Cat.No. : ATP2A3-31352TH
Product Overview : Recombinant fragment of Human SERCA3 ATPase with N terminal proprietary tag. Predicted MW 38.83 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein length : 120 amino acids
Molecular Weight : 38.830kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPT SREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDD CSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR
Sequence Similarities : Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily.
Gene Name : ATP2A3 ATPase, Ca++ transporting, ubiquitous [ Homo sapiens ]
Official Symbol : ATP2A3
Synonyms : ATP2A3; ATPase, Ca++ transporting, ubiquitous; sarcoplasmic/endoplasmic reticulum calcium ATPase 3; SERCA3;
Gene ID : 489
mRNA Refseq : NM_005173
Protein Refseq : NP_005164
MIM : 601929
Uniprot ID : Q93084
Chromosome Location : 17p13.3
Pathway : Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem;
Function : ATP binding; calcium-transporting ATPase activity; hydrolase activity; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; metal ion binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
What is the mutation mechanism of ATP2A3 recombinant protein? 05/22/2022

Mutations in the recombinant ATP2A3 protein may lead to abnormal changes in its intracellular localization and function, thereby affecting the normal function of cardiomyocytes.

Does the recombinant ATP2A3 protein interact with specific drugs? 02/11/2022

Certain drugs can affect the function of ATP2A3 recombinant protein, such as calcium modulators and cardiovascular drugs. These drugs may affect the intracellular calcium balance and the normal function of the cardiovascular system.

Are the expression and function of ATP2A3 recombinant protein regulated in the heart? 01/07/2022

Yes, the expression and function of ATP2A3 recombinant protein in the heart are regulated by complex regulatory mechanisms, including endogenous signaling pathways and regulation of the cardiovascular system.

What is the expression pattern of the recombinant ATP2A3 protein in humans? 09/18/2021

ATP2A3 recombinant protein is mainly expressed in muscle tissue, heart, kidney and other tissues and organs in the human body.

Are mutations in the recombinant ATP2A3 protein associated with human cardiovascular disease? 08/18/2019

Yes, mutations in ATP2A3 recombinant protein may be associated with certain cardiovascular diseases (such as myocardial infarction, heart failure, etc.).

What is the function of ATP2A3 recombinant protein in the heart? 07/08/2019

The main role of ATP2A3 recombinant protein in the heart is to regulate the intracellular calcium balance of muscle cells and participate in the regulation of myocardial contraction and relaxation.

Customer Reviews (3)

Write a review
Reviews
09/19/2022

    The green production process of ATP2A3 is very environmentally friendly. From the selection of raw materials to the production process, it reflects the concept of green production, without any negative impact on the environment.

    04/02/2020

      Its repeatability can be said to be unparalleled, and the consistent results in every experiment or application is an important manifestation of its superior quality.

      01/31/2019

        ATP2A3 has a short half-life and high clearance, making it more advantageous in emergency situations where a rapid therapeutic effect is required.

        Ask a Question for All ATP2A3 Products

        Required fields are marked with *

        My Review for All ATP2A3 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends