Recombinant Human ATP2A3
Cat.No. : | ATP2A3-31352TH |
Product Overview : | Recombinant fragment of Human SERCA3 ATPase with N terminal proprietary tag. Predicted MW 38.83 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction. Alternative splicing results in multiple transcript variants encoding different isoforms. |
Protein length : | 120 amino acids |
Molecular Weight : | 38.830kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Found in most tissues. Most abundant in thymus, trachea, salivary gland, spleen, bone marrow, lymph node, peripheral leukocytes, pancreas and colon. Also detected in fetal tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | TRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPT SREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDD CSKFVQYETDLTFVGCVGMLDPPRPEVAACITRCYQAGIR |
Sequence Similarities : | Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIA subfamily. |
Gene Name : | ATP2A3 ATPase, Ca++ transporting, ubiquitous [ Homo sapiens ] |
Official Symbol : | ATP2A3 |
Synonyms : | ATP2A3; ATPase, Ca++ transporting, ubiquitous; sarcoplasmic/endoplasmic reticulum calcium ATPase 3; SERCA3; |
Gene ID : | 489 |
mRNA Refseq : | NM_005173 |
Protein Refseq : | NP_005164 |
MIM : | 601929 |
Uniprot ID : | Q93084 |
Chromosome Location : | 17p13.3 |
Pathway : | Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Calcium signaling pathway, organism-specific biosystem; Calcium signaling pathway, conserved biosystem; |
Function : | ATP binding; calcium-transporting ATPase activity; hydrolase activity; hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances; metal ion binding; |
Products Types
◆ Recombinant Protein | ||
Atp2a3-1766M | Recombinant Mouse Atp2a3 Protein, Myc/DDK-tagged | +Inquiry |
ATP2A3-2942H | Recombinant Human ATP2A3 Protein, MYC/DDK-tagged | +Inquiry |
ATP2A3-401H | Recombinant Human ATP2A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP2A3-516R | Recombinant Rat ATP2A3 Protein, His (Fc)-Avi-tagged | +Inquiry |
ATP2A3-971H | Recombinant Human ATP2A3 protein, GST-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionMutations in the recombinant ATP2A3 protein may lead to abnormal changes in its intracellular localization and function, thereby affecting the normal function of cardiomyocytes.
Certain drugs can affect the function of ATP2A3 recombinant protein, such as calcium modulators and cardiovascular drugs. These drugs may affect the intracellular calcium balance and the normal function of the cardiovascular system.
Yes, the expression and function of ATP2A3 recombinant protein in the heart are regulated by complex regulatory mechanisms, including endogenous signaling pathways and regulation of the cardiovascular system.
ATP2A3 recombinant protein is mainly expressed in muscle tissue, heart, kidney and other tissues and organs in the human body.
Yes, mutations in ATP2A3 recombinant protein may be associated with certain cardiovascular diseases (such as myocardial infarction, heart failure, etc.).
The main role of ATP2A3 recombinant protein in the heart is to regulate the intracellular calcium balance of muscle cells and participate in the regulation of myocardial contraction and relaxation.
Customer Reviews (3)
Write a reviewThe green production process of ATP2A3 is very environmentally friendly. From the selection of raw materials to the production process, it reflects the concept of green production, without any negative impact on the environment.
Its repeatability can be said to be unparalleled, and the consistent results in every experiment or application is an important manifestation of its superior quality.
ATP2A3 has a short half-life and high clearance, making it more advantageous in emergency situations where a rapid therapeutic effect is required.
Ask a Question for All ATP2A3 Products
Required fields are marked with *
My Review for All ATP2A3 Products
Required fields are marked with *
Inquiry Basket