Recombinant Human CCND1 protein, His-tagged
Cat.No. : | CCND1-3456H |
Product Overview : | Recombinant Human CCND1 protein(1-42 aa), fused to His tag, was expressed in E. coli. |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
Source : | E. coli |
Species : | Human |
Tag : | His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
Protein length : | 1-42 aa |
AA Sequence : | MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSV |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name : | CCND1 cyclin D1 (PRAD1: parathyroid adenomatosis 1) [ Homo sapiens ] |
Official Symbol : | CCND1 |
Synonyms : | CCND1; cyclin D1 (PRAD1: parathyroid adenomatosis 1); BCL1, cyclin D1 (PRAD1: parathyroid adenomatosis 1) , D11S287E, PRAD1; B cell CLL/lymphoma 1; G1/S specific cyclin D1; parathyroid adenomatosis 1; U21B31; BCL-1; PRAD1; D11S287E; |
Gene ID : | 893 |
MIM : | 168461 |
UniProt ID : | P24385 |
Products Types
◆ Recombinant Protein | ||
CCND1-526R | Recombinant Rhesus Macaque CCND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCND1-1403M | Recombinant Mouse CCND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCND1-877R | Recombinant Rat CCND1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCND1-0658H | Recombinant Human CCND1 Protein, GST-Tagged | +Inquiry |
CCND1-001HB | Recombinant Human CCND1 Protein, His/Avi tagged, Biotinylated | +Inquiry |
◆ Lysates | ||
CCND1-7713HCL | Recombinant Human CCND1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket