Recombinant Human CCNG1 protein, GST-tagged

• Cat.No.: CCNG1-3613H
• Product Overview: Recombinant Human CCNG1 protein(1-46 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 1-46 aa
• AA Sequence: MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLR
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: CCNG1 cyclin G1 [ Homo sapiens ]
• Official Symbol: CCNG1
• Synonyms: CCNG1; cyclin G1; CCNG; cyclin-G1; cyclin-G
• Gene ID: 900
• mRNA Refseq: NM_004060
• Protein Refseq: NP_004051
• MIM: 601578
• UniProt ID: P51959

Reviews

12/10/2022

Consistently delivers, boosts research productivity.

10/22/2020

Integral to our research, dependable analysis.

08/26/2018

Streamlines our experiments, saving time and effort.

Q&As

What potential does CCNG1 have as a therapeutic target in cancer treatment?

Targeting CCNG1 in cancer therapy could help control tumor growth by affecting cell cycle dynamics.

What is the impact of CCNG1 dysregulation in the progression of various cancers?

Dysregulated CCNG1 expression is linked with the advancement of various cancers due to its role in cell cycle control.

What is the primary function of CCNG1 in cell cycle regulation?

CCNG1, as a cyclin, regulates the cell cycle, particularly the transition between phases.

How does CCNG1 influence cellular senescence and aging?

It contributes to cellular senescence by influencing cell cycle arrest mechanisms.

How do genetic alterations in CCNG1 affect its role in cell cycle regulation and cancer development?

Mutations in CCNG1 can lead to aberrant cell cycle progression, potentially resulting in cancer.

How does CCNG1 interact with other cell cycle regulators and signaling pathways?

CCNG1 works in tandem with other cell cycle proteins and signaling pathways to regulate cell division.

What role does CCNG1 play in DNA damage response and repair mechanisms?

CCNG1 plays a role in DNA damage response, helping to maintain genomic stability.