Recombinant Human CLDN3
Cat.No. : | CLDN3-27271TH |
Product Overview : | Recombinant full length Human Claudin 3 with an N terminal proprietary tag; Predicted MWt 50.31 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat. |
Protein length : | 220 amino acids |
Molecular Weight : | 50.310kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNII TSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR ALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMG AGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSA PRSTGPGASLGTGYDRKDYV |
Sequence Similarities : | Belongs to the claudin family. |
Gene Name : | CLDN3 claudin 3 [ Homo sapiens ] |
Official Symbol : | CLDN3 |
Synonyms : | CLDN3; claudin 3; C7orf1, CPETR2; claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE R2; CPE receptor 2; HRVP1; RVP1; ventral prostate.1 like protein; |
Gene ID : | 1365 |
mRNA Refseq : | NM_001306 |
Protein Refseq : | NP_001297 |
MIM : | 602910 |
Uniprot ID : | O15551 |
Chromosome Location : | 7q11 |
Pathway : | Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Cell junction organization, organism-specific biosystem; Cell-Cell communication, organism-specific biosystem; Cell-cell junction organization, organism-specific biosystem; |
Function : | identical protein binding; structural molecule activity; transmembrane signaling receptor activity; |
Products Types
◆ Recombinant Protein | ||
CLDN3-2789H | Recombinant Human CLDN3 Protein, His-tagged, OVA Conjugated | +Inquiry |
CLDN3-721R | Recombinant Rhesus Macaque CLDN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN3-1093R | Recombinant Rat CLDN3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN3-1442H | Recombinant Human CLDN3 Protein, GST-tagged | +Inquiry |
CLDN3-895R | Recombinant Rhesus monkey CLDN3 Protein, His-tagged | +Inquiry |
◆ Lysates | ||
CLDN3-7463HCL | Recombinant Human CLDN3 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionResearchers are exploring the use of CLDN3 as a target for drug delivery systems, aiming to enhance the specificity of drug delivery to tissues expressing high levels of CLDN3.
CLDN3 is involved in the tight junctions of intestinal epithelial cells, influencing the permeability of the intestinal barrier and playing a role in conditions like IBD.
CLDN3 is under investigation in various conditions, including infectious diseases, where its role in tight junctions may have implications for host-pathogen interactions.
Yes, CLDN3 is implicated in the pathogenesis of inflammatory bowel diseases, and its expression levels are being studied as potential markers for disease severity.
Altered expression of CLDN3 in the blood-brain barrier is associated with certain neurodegenerative diseases, making it a subject of interest for researchers studying these conditions.
Customer Reviews (3)
Write a reviewThe manufacturer's deep understanding of the protein and its applications enables them to promptly and effectively address any issues that may arise during my trials.
It minimizes the risk of protein degradation and maximizes the effectiveness of the protein in various applications, such as cell signaling pathways or metabolic studies.
This stability is particularly advantageous for long-term studies or experiments involving extended incubation periods.
Ask a Question for All CLDN3 Products
Required fields are marked with *
My Review for All CLDN3 Products
Required fields are marked with *
Inquiry Basket