Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human CST4

Cat.No. : CST4-27162TH
Product Overview : Recombinant full length Human Cystatin S with N terminal proprietary tag; Predicted MWt 41.58 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The cystatin superfamily encompasses proteins that contain multiple cystatin-like sequences. Some of the members are active cysteine protease inhibitors, while others have lost or perhaps never acquired this inhibitory activity. There are three inhibitory families in the superfamily, including the type 1 cystatins (stefins), type 2 cystatins and the kininogens. The type 2 cystatin proteins are a class of cysteine proteinase inhibitors found in a variety of human fluids and secretions. The cystatin locus on chromosome 20 contains the majority of the type 2 cystatin genes and pseudogenes. This gene is located in the cystatin locus and encodes a type 2 salivary cysteine peptidase inhibitor. The protein is an S-type cystatin, based on its high level of expression in saliva, tears and seminal plasma. The specific role in these fluids is unclear but antibacterial and antiviral activity is present, consistent with a protective function.
Protein length : 141 amino acids
Molecular Weight : 41.580kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Expressed in submandibular and sublingual saliva but not in parotid saliva (at protein level). Expressed in saliva, tears, urine and seminal fluid.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLN DEWVQRALHFAISEYNKATEDEYYRRPLQVLRAREQTFGG VNYFFDVEVGRTICTKSQPNLDTCAFHEQPELQKKQLCSF EIYEVPWEDRMSLVNSRCQEA
Sequence Similarities : Belongs to the cystatin family.
Gene Name : CST4 cystatin S [ Homo sapiens ]
Official Symbol : CST4
Synonyms : CST4; cystatin S; cystatin-S;
Gene ID : 1472
mRNA Refseq : NM_001899
Protein Refseq : NP_001890
MIM : 123857
Uniprot ID : P01036
Chromosome Location : 20p11.2
Pathway : Salivary secretion, organism-specific biosystem; Salivary secretion, conserved biosystem;
Function : cysteine-type endopeptidase inhibitor activity; peptidase inhibitor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All CST4 Products

Required fields are marked with *

My Review for All CST4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends