Recombinant Human DCPS, His-tagged
Cat.No. : | DCPS-27368TH |
Product Overview : | Recombinant full-length Human DCPS (amino acids 1-337) with a N terminal His tag. 357 amino acids with a predicted MWt 40.8 kDa including tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Scavenger mRNA-decapping enzyme DcpS is a protein that in humans is encoded by the DCPS gene. |
Protein length : | 337 amino acids |
Conjugation : | HIS |
Molecular Weight : | 40.800kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Detected in liver, brain, kidney, testis and prostate. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 20% Glycerol, 0.02% DTT |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. Mix suspension via gentle inversion before use. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMADAAPQLGKRKRELDV EEAHAASTEEKEAGVGNGTCAPVRLPFSGFRLQKVLRE SARDKIIFLHGKVNEASGDGDGEDAVVILEKTPFQVEQVA QLLTGSPELQLQFSNDIYSTYHLFPPRQLNDVKTTVVY PATEKHLQKYLRQDLRLIRETGDDYRNITLPHLESQSLSI QWVYNILDKKAEADRIVFENPDPSDGFVLIPDLKWNQQ QLDDLYLIAICHRRGIRSLRDLTPEHLPLLRNILHQGQEA ILQRYRMKGDHLRVYLHYLPSYYHLHVHFTALGFEAPG SGVERAHLLAEVIENLECDPRHYQQRTLTFALRADDPLLK LLQEAQQS |
Sequence Similarities : | Belongs to the HIT family. |
Gene Name : | DCPS decapping enzyme, scavenger [ Homo sapiens ] |
Official Symbol : | DCPS |
Synonyms : | DCPS; decapping enzyme, scavenger; scavenger mRNA-decapping enzyme DcpS; HINT 5; HSL1; HSPC015; |
Gene ID : | 28960 |
mRNA Refseq : | NM_014026 |
Protein Refseq : | NP_054745 |
MIM : | 610534 |
Uniprot ID : | Q96C86 |
Chromosome Location : | 11q24 |
Pathway : | Deadenylation-dependent mRNA decay, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of RNA, organism-specific biosystem; Metabolism of mRNA, organism-specific biosystem; RNA degradation, organism-specific biosystem; |
Function : | hydrolase activity; protein binding; |
Products Types
◆ Recombinant Protein | ||
DCPS-01C | Recombinant Cynomolgus monkey DCPS Protein, His-tagged | +Inquiry |
Dcps-2478M | Recombinant Mouse Dcps Protein, Myc/DDK-tagged | +Inquiry |
DCPS-11862H | Recombinant Human DCPS protein(1-337 aa), His-tagged | +Inquiry |
DCPS-2237M | Recombinant Mouse DCPS Protein, His (Fc)-Avi-tagged | +Inquiry |
DCPS-1798R | Recombinant Rat DCPS Protein, His-tagged | +Inquiry |
◆ Lysates | ||
DCPS-7046HCL | Recombinant Human DCPS 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DCPS Products
Required fields are marked with *
My Review for All DCPS Products
Required fields are marked with *
0
Inquiry Basket