Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DDX50, His-tagged

Cat.No. : DDX50-28327TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-270 of Human DDX50 with N terminal His tag; Predicted MWt 32 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box enzyme that may be involved in ribosomal RNA synthesis or processing. This gene and DDX21, also called RH-II/GuA, have similar genomic structures and are in tandem orientation on chromosome 10, suggesting that the two genes arose by gene duplication in evolution. This gene has pseudogenes on chromosomes 2, 3 and 4. Alternative splicing of this gene generates multiple transcript variants, but the full length nature of all the other variants but one has not been defined.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 107 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MPGKLLWGDIMELEAPLEESESQKKERQKSDRRKSRHHYD SDEKSETRENGVTDDLDAPKAKKSKMKEKLNGDTEEGF NRLSDEFSKSHKSRRKDLPNGDIDEYEKKSKRVSSLDT STHKSSDNKLEETLTREQKEGAFSNFPISEETIKLLKG RGVTYLFPIQVKTFGPVYEGKDLIAQARTGTGKTFSFAIP LIERLQRNQETIKKSRSPKVLVLAPTRELANQVAKDFK DITRKLSVACFYGGTSYQSQINHIRNGIDILVGTPGRI
Sequence Similarities : Belongs to the DEAD box helicase family. DDX21/DDX50 subfamily.Contains 1 helicase ATP-binding domain.Contains 1 helicase C-terminal domain.
Gene Name : DDX50 DEAD (Asp-Glu-Ala-Asp) box polypeptide 50 [ Homo sapiens ]
Official Symbol : DDX50
Synonyms : DDX50; DEAD (Asp-Glu-Ala-Asp) box polypeptide 50; ATP-dependent RNA helicase DDX50; GU2; GUB; MGC3199; RH II/GuB;
Gene ID : 79009
mRNA Refseq : NM_024045
Protein Refseq : NP_076950
MIM : 610373
Uniprot ID : Q9BQ39
Chromosome Location : 10q22.2
Function : ATP binding; ATP-dependent helicase activity; RNA binding; helicase activity; hydrolase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DDX50 Products

Required fields are marked with *

My Review for All DDX50 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends