Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human DVL1

Cat.No. : DVL1-28351TH
Product Overview : Recombinant fragment of Human Dishevelled / Dvl1 with N terminal proprietary tag, 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNR PVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSW LVLAEGAHSDAGSQGTDSHTDLPPPLERTG
Sequence Similarities : Belongs to the DSH family.Contains 1 DEP domain.Contains 1 DIX domain.Contains 1 PDZ (DHR) domain.
Gene Name : DVL1 dishevelled, dsh homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol : DVL1
Synonyms : DVL1; dishevelled, dsh homolog 1 (Drosophila); dishevelled 1 (homologous to Drosophila dsh); segment polarity protein dishevelled homolog DVL-1;
Gene ID : 1855
mRNA Refseq : NM_004421
Protein Refseq : NP_004412
MIM : 601365
Uniprot ID : O14640
Chromosome Location : 1p36
Pathway : Adipogenesis, organism-specific biosystem; Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem;
Function : Rac GTPase binding; Rac GTPase binding; enzyme binding; frizzled binding; identical protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All DVL1 Products

Required fields are marked with *

My Review for All DVL1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends