Recombinant Human DVL1
Cat.No. : | DVL1-28351TH |
Product Overview : | Recombinant fragment of Human Dishevelled / Dvl1 with N terminal proprietary tag, 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | DVL1, the human homolog of the Drosophila dishevelled gene (dsh) encodes a cytoplasmic phosphoprotein that regulates cell proliferation, acting as a transducer molecule for developmental processes, including segmentation and neuroblast specification. DVL1 is a candidate gene for neuroblastomatous transformation. The Schwartz-Jampel syndrome and Charcot-Marie-Tooth disease type 2A have been mapped to the same region as DVL1. The phenotypes of these diseases may be consistent with defects which might be expected from aberrant expression of a DVL gene during development. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNR PVHAYKFFFKSMDQDFGVVKEEIFDDNAKLPCFNGRVVSW LVLAEGAHSDAGSQGTDSHTDLPPPLERTG |
Sequence Similarities : | Belongs to the DSH family.Contains 1 DEP domain.Contains 1 DIX domain.Contains 1 PDZ (DHR) domain. |
Gene Name : | DVL1 dishevelled, dsh homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol : | DVL1 |
Synonyms : | DVL1; dishevelled, dsh homolog 1 (Drosophila); dishevelled 1 (homologous to Drosophila dsh); segment polarity protein dishevelled homolog DVL-1; |
Gene ID : | 1855 |
mRNA Refseq : | NM_004421 |
Protein Refseq : | NP_004412 |
MIM : | 601365 |
Uniprot ID : | O14640 |
Chromosome Location : | 1p36 |
Pathway : | Adipogenesis, organism-specific biosystem; Basal cell carcinoma, organism-specific biosystem; Basal cell carcinoma, conserved biosystem; Canonical Wnt signaling pathway, organism-specific biosystem; DNA damage response (only ATM dependent), organism-specific biosystem; |
Function : | Rac GTPase binding; Rac GTPase binding; enzyme binding; frizzled binding; identical protein binding; |
Products Types
◆ Recombinant Protein | ||
DVL1-1638R | Recombinant Rat DVL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DVL1-2959H | Recombinant Human DVL1 Protein, GST-tagged | +Inquiry |
DVL1-2574M | Recombinant Mouse DVL1 Protein, His (Fc)-Avi-tagged | +Inquiry |
DVL1-1980R | Recombinant Rat DVL1 Protein | +Inquiry |
DVL1-1682H | Recombinant Human DVL1 protein, His & T7-tagged | +Inquiry |
◆ Lysates | ||
DVL1-6766HCL | Recombinant Human DVL1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All DVL1 Products
Required fields are marked with *
My Review for All DVL1 Products
Required fields are marked with *
0
Inquiry Basket