Recombinant Human GCNT1
Cat.No. : | GCNT1-27452TH |
Product Overview : | Recombinant full length Human GCNT1 with N-terminal proprietary tag. Predicted MW 73.15kDa. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene is a member of the beta-1,6-N-acetylglucosaminyltransferase gene family. It is essential to the formation of Gal beta 1-3(GlcNAc beta 1-6)GalNAc structures and the core 2 O-glycan branch. The gene coding this enzyme was originally mapped to 9q21, but was later localized to 9q13. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Protein length : | 428 amino acids |
Molecular Weight : | 73.150kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Highly expressed in activated T-lymphocytes and myeloid cells. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MLRTLLRRRLFSYPTKYYFMVLVLSLITFSVLRIHQKPEF VSVRHLELAGENPSSDINCTKVLQGDVNEIQKVKLEILTV KFKKRPRWTPDDYINMTSDCSSFIKRRKYIVEPLSKEEAE FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDTKSED SYLAAVMGIASCFSNVFVASRLESVVYASWSRVQADLNCM KDLYAMSANWKYLINLCGMDFPIKTNLEIVRKLKLLMGEN NLETERMPSHKEERWKKRYEVVNGKLTNTGTVKMLPPLET PLFSGSAYFVVSREYVGYVLQNEKIQKLMEWAQDTYSPDE YLWATIQRIPEVPGSLPASHKYDLSDMQAVARFVKWQYFE GDVSKGAPYPPCDGVHVRSVCIFGAGDLNWMLRKHHLFAN KFDVDVDLFAIQCLDEHLRHKALETLKH |
Sequence Similarities : | Belongs to the glycosyltransferase 14 family. |
Gene Name : | GCNT1 glucosaminyl (N-acetyl) transferase 1, core 2 [ Homo sapiens ] |
Official Symbol : | GCNT1 |
Synonyms : | GCNT1; glucosaminyl (N-acetyl) transferase 1, core 2; glucosaminyl (N acetyl) transferase 1, core 2 (beta 1,6 N acetylglucosaminyltransferase) , NACGT2; beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase; beta 1; 3 galact |
Gene ID : | 2650 |
mRNA Refseq : | NM_001097633 |
Protein Refseq : | NP_001091102 |
MIM : | 600391 |
Uniprot ID : | Q02742 |
Chromosome Location : | 9q13 |
Pathway : | Metabolic pathways, organism-specific biosystem; Mucin type O-Glycan biosynthesis, organism-specific biosystem; Mucin type O-Glycan biosynthesis, conserved biosystem; O-glycan biosynthesis, mucin type core, organism-specific biosystem; O-glycan biosynthesis, mucin type core, conserved biosystem; |
Function : | beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase activity; transferase activity, transferring glycosyl groups; |
Products Types
◆ Recombinant Protein | ||
GCNT1-3025H | Recombinant Human GCNT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GCNT1-4804H | Recombinant Human GCNT1 Protein, GST-tagged | +Inquiry |
GCNT1-714H | Active Recombinant Human GCNT1, His-tagged | +Inquiry |
GCNT1-13198H | Recombinant Human GCNT1, GST-tagged | +Inquiry |
GCNT1-617H | Active Recombinant Human Glucosaminyl (N-acetyl) Transferase 1, Core 2, His-tagged | +Inquiry |
◆ Lysates | ||
GCNT1-5980HCL | Recombinant Human GCNT1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (0)
Ask a questionAsk a Question for All GCNT1 Products
Required fields are marked with *
My Review for All GCNT1 Products
Required fields are marked with *
0
Inquiry Basket