Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human HTR1B Protein, GST-tagged

Cat.No. : HTR1B-5251H
Product Overview : Human HTR1B partial ORF ( NP_000854, 1 a.a. - 49 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
Description : The neurotransmitter serotonin (5-hydroxytryptamine; 5-HT) exerts a wide variety of physiologic functions through a multiplicity of receptors and may be involved in human neuropsychiatric disorders such as anxiety, depression, or migraine. These receptors consist of 4 main groups, 5-HT-1, 5-HT-2, 5-HT-3, and 5-HT4, subdivided into several distinct subtypes on the basis of their pharmacologic characteristics, coupling to intracellular second messengers, and distribution within the nervous system (Zifa and Fillion, 1992 [PubMed 1359584]). The serotonergic receptors belong to the multigene family of receptors coupled to guanine nucleotide-binding proteins.[supplied by OMIM
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 31.13 kDa
AA Sequence : MEEPGAQCAPPPPAGSETWVPQANLSSAPSQNCSAKDYIYQDSISLPWK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : HTR1B 5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled [ Homo sapiens ]
Official Symbol : HTR1B
Synonyms : HTR1B; 5-hydroxytryptamine (serotonin) receptor 1B, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 1B; 5-hydroxytryptamine receptor 1B; 5 HT1B; 5 HT1DB; HTR1D2; S12; 5-HT-1B; 5-HT-1D-beta; serotonin receptor 1B; serotonin 1D beta receptor; 5-HT1B; HTR1DB; 5-HT1DB;
Gene ID : 3351
mRNA Refseq : NM_000863
Protein Refseq : NP_000854
MIM : 182131
UniProt ID : P28222

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends