Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human ILF3, His-tagged

Cat.No. : ILF3-29491TH
Product Overview : Recombinant fragment, corresponding to amino acids 29-452 of Human ILF3 with N terminal His tag; 48.8 kDa ;
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a double-stranded RNA (dsRNA) binding protein that complexes with other proteins, dsRNAs, small noncoding RNAs, and mRNAs to regulate gene expression and stabilize mRNAs. This protein was first discovered to be a subunit of the nuclear factor of activated T-cells (NFAT); a transcription factor required for T-cell expression of interleukin 2. NFAT is a heterodimer of 45 kDa and 90 kDa proteins, the larger of which is the product of this gene. These proteins have been shown to affect the redistribution of nuclear mRNA to the cytoplasm. Knockdown of NF45 or NF90 protein retards cell growth; possibly by inhibition of mRNA stabilization. In contrast, an isoform (NF110) of this gene that is predominantly restricted to the nucleus has only minor effects on cell growth when its levels are reduced. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Conjugation : HIS
Source : E. coli
Tissue specificity : Ubiquitous.
Form : Lyophilised:Reconstitute with 49μl distilled water.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : EAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVP PEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAKGLLLKG DLDLELVLLCKEKPTTALLDKVADNLAIQLAAVTEDKY EILQSVDDAAIVIKNTKEPPLSLTIHLTSPVVREEMEK VLAGETLSVNDPPDVLDRQKCLAALASLRHAKWFQARANG LKSCVIVIRVLRDLCTRVPTWGPLRGWPLELLCEKSIG TANRPMGAGEALRRVLECLASGIVMPDGSGIYDPCEKE ATDAIGHLDRQQREDITQSAQHALRLAAFGQLHKVLGM DPLPSKMPKKPKNENPVDYTVQIPPSTTYAITPMKRPM EEDGEEKSPSKKKKKIQKKEEKAEPPQAMNALMRLNQLKP GLQYKLVSQTGPVHAPIFTMSVEVDGNSFEASGPSKKT
Sequence Similarities : Contains 2 DRBM (double-stranded RNA-binding) domains.Contains 1 DZF domain.
Gene Name : ILF3 interleukin enhancer binding factor 3, 90kDa [ Homo sapiens ]
Official Symbol : ILF3
Synonyms : ILF3; interleukin enhancer binding factor 3, 90kDa; interleukin enhancer binding factor 3, 90kD; interleukin enhancer-binding factor 3; DRBP76; M phase phosphoprotein 4; MPHOSPH4; MPP4; NF90; NFAR 1;
Gene ID : 3609
mRNA Refseq : NM_001137673
Protein Refseq : NP_001131145
MIM : 603182
Uniprot ID : Q12906
Chromosome Location : 19p13.2
Function : DNA binding; RNA binding; double-stranded RNA binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (6)

Ask a question
Which tumors are associated with ILF3? What role does it play in tumor development? 12/07/2019

This is associated with a variety of tumors, including breast cancer, lung cancer, and colon cancer. In tumor development, ILF3 may promote cell proliferation, apoptosis inhibition, and metastasis.

What progress has been made in the exploration of new methods and new drugs for ILF3 treatment of tumors? 11/04/2019

At present for ILF3 new treatment for cancer and new drug exploration is still in its infancy, but some ILF3 related drugs and treatment strategies are in development and evaluation, bring new hope for patients.

Is ILF3 associated with tumor microenvironment and immune escape? 10/29/2019

This peotein may be associated with tumor microenvironment and immune escape, and can regulate the interaction between tumor cells and immune cells, further deepening our understanding of the mechanism of immune escape.

Is there a relationship between LF3 and tumor prognosis and treatment response? 06/29/2019

The association between ILF3 and tumor prognosis and treatment response needs to be further studied, but according to the current study, high expression of ILF3 may be associated with poor prognosis and drug resistance in cancer patients.

What are the functions and mechanisms of ILF3 in infectious diseases? 04/23/2019

ILF3 may play an important immunomodulatory function in infectious diseases and may be involved in the immune response and inflammatory response caused by viral or bacterial infection.

What is ILF3 role in autoimmune diseases? What autoimmune diseases might it be involved in? 01/14/2019

It may play an important role in autoimmune diseases, such as rheumatoid arthritis and systemic lupus erythematosus (sle), may be involved in these diseases by means of immune regulation of occurrence and development.

Customer Reviews (3)

Write a review
Reviews
07/17/2022

    The impurities are not obvious, clear and transparent, and the purity is high.

    07/13/2022

      It can meet the needs of daily experiments, and the expression effect is good.

      02/27/2021

        ILF3 has performed well in experiments and is a reliable choice.

        Ask a Question for All ILF3 Products

        Required fields are marked with *

        My Review for All ILF3 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends