Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human KLRC3

Cat.No. : KLRC3-29905TH
Product Overview : Recombinant fragment of Human KLRC3 with a N terminal proprietary tag; Predicted MWt 37.62 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Natural killer (NK) cells are lymphocytes that can mediate lysis of certain tumor cells and virus-infected cells without previous activation. They can also regulate specific humoral and cell-mediated immunity. NK cells preferentially express several calcium-dependent (C-type) lectins, which have been implicated in the regulation of NK cell function. KLRC3 is a member of the NKG2 group which are expressed primarily in natural killer (NK) cells and encodes a family of transmembrane proteins characterized by a type II membrane orientation (extracellular C terminus) and the presence of a C-type lectin domain. The NKG2 gene family is located within the NK complex, a region that contains several C-type lectin genes preferentially expressed on NK cells. Alternative splicing results in multiple transcript variants encoding different isoforms.
Protein length : 109 amino acids
Molecular Weight : 37.620kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Natural killer cells.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLASILPS SWIGVFRNSSHHPWVTINGLAFKHEIKDSDHAERNCAMLH VRGLISDQCGSSRIIRRGFIMLTRLVLNS
Sequence Similarities : Contains 1 C-type lectin domain.
Gene Name : KLRC3 killer cell lectin-like receptor subfamily C, member 3 [ Homo sapiens ]
Official Symbol : KLRC3
Synonyms : KLRC3; killer cell lectin-like receptor subfamily C, member 3; NKG2-E type II integral membrane protein; NKG2 E;
Gene ID : 3823
mRNA Refseq : NM_002261
Protein Refseq : NP_002252
MIM : 602892
Uniprot ID : Q07444
Chromosome Location : 12p13
Pathway : Antigen processing and presentation, organism-specific biosystem; Antigen processing and presentation, conserved biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem;
Function : binding; receptor activity; sugar binding; transmembrane signaling receptor activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All KLRC3 Products

Required fields are marked with *

My Review for All KLRC3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends