Recombinant Human LIFR
Cat.No. : | LIFR-28855TH |
Product Overview : | Recombinant fragment of Human LIFR with N terminal proprietary tag, 37.73kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein that belongs to the type I cytokine receptor family. This protein combines with a high-affinity converter subunit, gp130, to form a receptor complex that mediates the action of the leukemia inhibitory factor, a polyfunctional cytokine that is involved in cellular differentiation, proliferation and survival in the adult and the embryo. Mutations in this gene cause Schwartz-Jampel syndrome type 2, a disease belonging to the group of the bent-bone dysplasias. A translocation that involves the promoter of this gene, t(5;8)(p13;q12) with the pleiomorphic adenoma gene 1, is associated with salivary gland pleiomorphic adenoma, a common type of benign epithelial tumor of the salivary gland. Multiple splice variants encoding the same protein have been found for this gene. |
Protein length : | 110 amino acids |
Molecular Weight : | 37.730kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | QKKGAPHDLKCVTNNLQVWNCSWKAPSGTGRGTDYEVCIE NRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSK FTLNEQNVSLIPDTPEILNLSADFSTSTLY |
Gene Name : | LIFR leukemia inhibitory factor receptor alpha [ Homo sapiens ] |
Official Symbol : | LIFR |
Synonyms : | LIFR; leukemia inhibitory factor receptor alpha; leukemia inhibitory factor receptor; CD118; |
Gene ID : | 3977 |
mRNA Refseq : | NM_001127671 |
Protein Refseq : | NP_001121143 |
MIM : | 151443 |
Uniprot ID : | P42702 |
Chromosome Location : | 5p13-p12 |
Pathway : | Adipogenesis, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Jak-STAT signaling pathway, organism-specific biosystem; Jak-STAT signaling pathway, conserved biosystem; |
Function : | contributes_to ciliary neurotrophic factor receptor activity; ciliary neurotrophic factor receptor binding; cytokine binding; growth factor binding; leukemia inhibitory factor receptor activity; |
Products Types
◆ Recombinant Protein | ||
LIFR-351H | Recombinant Human LIFR Protein, Fc-tagged | +Inquiry |
LIFR-094H | Recombinant Human LIFR Protein, C-His-tagged | +Inquiry |
LIFR-868M | Active Recombinant Mouse LIFR protein(Met1-Ser828), His-tagged | +Inquiry |
LIFR-3064R | Recombinant Rat LIFR Protein, His (Fc)-Avi-tagged | +Inquiry |
LIFR-611H | Active Recombinant Human LIFR protein(Met1-Ser833), His-tagged | +Inquiry |
◆ Lysates | ||
LIFR-2778HCL | Recombinant Human LIFR cell lysate | +Inquiry |
LIFR-1200RCL | Recombinant Rat LIFR cell lysate | +Inquiry |
LIFR-2285MCL | Recombinant Mouse LIFR cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket