Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human NPPB protein

Cat.No. : NPPB-20H
Product Overview : Recombinant Human NPPB protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Brain Natriuretic Peptide is encoded by the BNP gene located on the Chr.1 in humans. It is firstly discovered in the porcine brain and given this name, but the protein is mainly expressed in the cardiac ventricles in human body after the excessive stretching of cardiomyocytes. The gene expresses a 134 a.a. sequence which contains a 1-26 a.a. signal peptide and 27-134 a.a. Natriuretic peptides B, and the BNP is the 32 a.a. C-terminus of natriuretic peptides B. The BNP can be cleaved in 16 chains and the rHuBNP is 1-32. BNP acts as a cardiac hormone with a variety of functions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Additionnaly, it plays a key role in cardiovascular homeostasis, helps restore the body's salt and water balance and improves heart function.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4.
Molecular Mass : Approximately 3.5 kDa, a single non-glycosylated polypeptide chain containing 32 amino acids.
Protein length : 32
AA Sequence : SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Endotoxin : Less than 1 EU/μg of rHuBNP as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : NPPB
Official Symbol : NPPB
Synonyms : NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP;
Gene ID : 4879
mRNA Refseq : NM_002521
Protein Refseq : NP_002512
MIM : 600295
UniProt ID : P16860

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
In what ways does NPPB protein contribute to the understanding of fluid overload in patients? 04/20/2022

Elevated NPPB levels are associated with fluid overload, providing valuable information for clinicians in managing patients with conditions like edema.

Can NPPB protein be used in monitoring the efficacy of treatments for cardiovascular diseases? 03/02/2020

Yes, monitoring NPPB levels over time can help assess the effectiveness of treatments and interventions in managing cardiovascular conditions.

How do age and gender influence the normal range of NPPB protein levels in healthy individuals? 04/25/2019

Normal ranges of NPPB may vary with age and gender. Understanding these variations is essential for accurate clinical interpretation.

Are there any specific contraindications or limitations in using NPPB protein as a clinical marker? 11/26/2016

While NPPB is a valuable marker, clinicians should consider factors like renal function and comorbidities that may affect its interpretation.

How does NPPB protein influence the management of hypertension in clinical practice? 06/11/2016

NPPB regulates blood pressure by promoting vasodilation and natriuresis. Understanding its levels can guide the management of hypertension.

Customer Reviews (3)

Write a review
Reviews
06/17/2022

    They actively engage with researchers, comprehending their specific experimental needs, and offering tailored services accordingly.

    01/16/2022

      This collaborative partnership facilitates a seamless and efficient research process, as the manufacturer aligns their support and services with my unique requirements.

      12/09/2019

        The manufacturer's excellent technical support, commitment to innovation, and customer-centric approach further reinforce its suitability for my research.

        Ask a Question for All NPPB Products

        Required fields are marked with *

        My Review for All NPPB Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends