Recombinant Human NPPB protein
Cat.No. : | NPPB-20H |
Product Overview : | Recombinant Human NPPB protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Description : | Brain Natriuretic Peptide is encoded by the BNP gene located on the Chr.1 in humans. It is firstly discovered in the porcine brain and given this name, but the protein is mainly expressed in the cardiac ventricles in human body after the excessive stretching of cardiomyocytes. The gene expresses a 134 a.a. sequence which contains a 1-26 a.a. signal peptide and 27-134 a.a. Natriuretic peptides B, and the BNP is the 32 a.a. C-terminus of natriuretic peptides B. The BNP can be cleaved in 16 chains and the rHuBNP is 1-32. BNP acts as a cardiac hormone with a variety of functions including natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Additionnaly, it plays a key role in cardiovascular homeostasis, helps restore the body's salt and water balance and improves heart function. |
Source : | E.coli |
Species : | Human |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4. |
Molecular Mass : | Approximately 3.5 kDa, a single non-glycosylated polypeptide chain containing 32 amino acids. |
Protein length : | 32 |
AA Sequence : | SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH |
Endotoxin : | Less than 1 EU/μg of rHuBNP as determined by LAL method. |
Purity : | >97% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name : | NPPB |
Official Symbol : | NPPB |
Synonyms : | NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP; |
Gene ID : | 4879 |
mRNA Refseq : | NM_002521 |
Protein Refseq : | NP_002512 |
MIM : | 600295 |
UniProt ID : | P16860 |
Products Types
◆ Recombinant Protein | ||
NPPB-8050H | Synthetic Human Brain Natriuretic Peptide 32 | +Inquiry |
NPPB-1298H | Recombinant Human NPPB Protein, GST-tagged | +Inquiry |
NPPB-6170M | Recombinant Mouse NPPB Protein, His (Fc)-Avi-tagged | +Inquiry |
Nppb-1852M | Recombinant Mouse Nppb Protein, His&GST-tagged | +Inquiry |
Nppb-390R | Recombinant Rat Nppb Protein, His&SUMO-tagged | +Inquiry |
◆ Native Protein | ||
Nppb-5459R | Native Rat Natriuretic Peptide B | +Inquiry |
NPPB-8052R | Native Rat Brain Natriuretic Peptide-32 | +Inquiry |
◆ Lysates | ||
NPPB-3734HCL | Recombinant Human NPPB 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionElevated NPPB levels are associated with fluid overload, providing valuable information for clinicians in managing patients with conditions like edema.
Yes, monitoring NPPB levels over time can help assess the effectiveness of treatments and interventions in managing cardiovascular conditions.
Normal ranges of NPPB may vary with age and gender. Understanding these variations is essential for accurate clinical interpretation.
While NPPB is a valuable marker, clinicians should consider factors like renal function and comorbidities that may affect its interpretation.
NPPB regulates blood pressure by promoting vasodilation and natriuresis. Understanding its levels can guide the management of hypertension.
Customer Reviews (3)
Write a reviewThey actively engage with researchers, comprehending their specific experimental needs, and offering tailored services accordingly.
This collaborative partnership facilitates a seamless and efficient research process, as the manufacturer aligns their support and services with my unique requirements.
The manufacturer's excellent technical support, commitment to innovation, and customer-centric approach further reinforce its suitability for my research.
Ask a Question for All NPPB Products
Required fields are marked with *
My Review for All NPPB Products
Required fields are marked with *
Inquiry Basket