Recombinant Human NPPB therapeutic protein

• Cat.No.: NPPB-P029H
• Product Overview: Recombinant Human Natriuretic Peptide B therapeutic protein is a medication used to treat acutely decompensated congestive heart failure with dyspnea at rest or with minimal exertion (such as talk, eating or bathing). It is the recombinant form of the 32 amino acid human B-type natriuretic peptide, which is normally produced by the ventricular myocardium.

Specification

• Description: This gene is a member of the natriuretic peptide family and encodes a secreted protein which functions as a cardiac hormone. The protein undergoes two cleavage events, one within the cell and a second after secretion into the blood. The protein's biological actions include natriuresis, diuresis, vasorelaxation, inhibition of renin and aldosterone secretion, and a key role in cardiovascular homeostasis. A high concentration of this protein in the bloodstream is indicative of heart failure. Mutations in this gene have been associated with postmenopausal osteoporosis. The expression product is the active ingredient of Natrecor and nesiritide.
• Species: Human
• Molecular Mass: 3464 Da
• Protein length: 32aa
• AA Sequence: SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
• Endotoxin: < 1.0 EU per μg of the protein
• Purity: >95%
• Storage: Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.

Gene Information

• Gene Name: NPPB natriuretic peptide B [ Homo sapiens ]
• Official Symbol: NPPB
• Synonyms: NPPB; natriuretic peptide B; natriuretic peptide precursor B; natriuretic peptides B; natriuretic protein; brain type natriuretic peptide; gamma-brain natriuretic peptide; BNP
• Gene ID: 4879
• mRNA Refseq: NM_002521
• Protein Refseq: NP_002512
• MIM: 600295
• UniProt ID: P16860
• Chromosome Location: 1p36.2
• Pathway: MicroRNAs in cardiomyocyte hypertrophy, organism-specific biosystem
• Function: diuretic hormone activity; hormone activity; peptide hormone receptor binding; receptor binding; receptor binding

Reviews

06/17/2022

They actively engage with researchers, comprehending their specific experimental needs, and offering tailored services accordingly.

01/16/2022

This collaborative partnership facilitates a seamless and efficient research process, as the manufacturer aligns their support and services with my unique requirements.

12/09/2019

The manufacturer's excellent technical support, commitment to innovation, and customer-centric approach further reinforce its suitability for my research.

Q&As

In what ways does NPPB protein contribute to the understanding of fluid overload in patients?

Elevated NPPB levels are associated with fluid overload, providing valuable information for clinicians in managing patients with conditions like edema.

Can NPPB protein be used in monitoring the efficacy of treatments for cardiovascular diseases?

Yes, monitoring NPPB levels over time can help assess the effectiveness of treatments and interventions in managing cardiovascular conditions.

How do age and gender influence the normal range of NPPB protein levels in healthy individuals?

Normal ranges of NPPB may vary with age and gender. Understanding these variations is essential for accurate clinical interpretation.

Are there any specific contraindications or limitations in using NPPB protein as a clinical marker?

While NPPB is a valuable marker, clinicians should consider factors like renal function and comorbidities that may affect its interpretation.

How does NPPB protein influence the management of hypertension in clinical practice?

NPPB regulates blood pressure by promoting vasodilation and natriuresis. Understanding its levels can guide the management of hypertension.