Recombinant Human PCSK6

• Cat.No.: PCSK6-30177TH
• Product Overview: Recombinant fragment corresponding to amino acids 860-969 of Human PACE4 with an N terminal proprietary tag; Predicted MWt 37.73 kDa.

Specification

• Description: The protein encoded by this gene belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. This encoded protein is a calcium-dependent serine endoprotease that can cleave precursor protein at their paired basic amino acid processing sites. Some of its substrates are - transforming growth factor beta related proteins, proalbumin, and von Willebrand factor. This gene is thought to play a role in tumor progression. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Protein length: 110 amino acids
• Molecular Weight: 37.730kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Each PACE4 isoform exhibits a unique restricted distribution. Isoform PACE4A-I is expressed in heart, brain, placenta, lung, skeletal muscle, kidney, pancreas, but at comparatively higher levels in the liver. Isoform PACE4A-II is at least expressed in pla
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: REECIHCAKNFHFHDWKCVPACGEGFYPEEMPGLPHKVCR RCDENCLSCAGSSRNCSRCKTGFTQLGTSCITNHTCSNAD ETFCEMVKSNRLCERKLFIQFCCRTCLLAG
• Sequence Similarities: Belongs to the peptidase S8 family.Contains 1 homo B/P domain.Contains 1 PLAC domain.

Gene Information

• Gene Name: PCSK6 proprotein convertase subtilisin/kexin type 6 [ Homo sapiens ]
• Official Symbol: PCSK6
• Synonyms: PCSK6; proprotein convertase subtilisin/kexin type 6; PACE4, paired basic amino acid cleaving system 4; SPC4; subtilisin like proprotein convertase 4; subtilisin like protease; subtilisin/kexin like protease PACE4
• Gene ID: 5046
• mRNA Refseq: NM_002570
• Protein Refseq: NP_002561
• MIM: 167405
• Uniprot ID: P29122
• Chromosome Location: 15q26
• Pathway: Developmental Biology, organism-specific biosystem; NGF processing, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by NODAL, organism-specific biosystem; Signalling by NGF, organism-specific biosystem
• Function: endopeptidase activity; eukaryotic cell surface binding; heparin binding; nerve growth factor binding; peptidase activity

Reviews

03/20/2019

Outstanding service. High-quality protein analysis.

01/10/2019

Top-notch support. Instrumental in our research achievements.

03/26/2018

Exceptional accuracy. Accelerates our research progress.

Q&As

How does PCSK6 influence the activation of growth factors and hormones?

It activates growth factors and hormones, influencing cell growth and differentiation.

What is the impact of altered PCSK6 activity in diseases like cancer?

Altered PCSK6 activity is associated with cancer progression, impacting cell growth.

What role does PCSK6 play in developmental processes and organogenesis?

PCSK6 is key in development, affecting organ formation and body patterning.

What is the primary function of PCSK6 in protein processing and regulation?

PCSK6 activates precursor proteins into their active forms, essential for protein regulation.

How do genetic variations in PCSK6 affect its enzymatic activity and contribute to developmental disorders?

Mutations in PCSK6 can disrupt protein processing, leading to developmental disorders.

How does PCSK6 interact with other proteases and signaling pathways in the cell?

PCSK6 cooperates with other proteases, playing a role in various cellular pathways.

What potential therapeutic applications could arise from modulating PCSK6 activity in various diseases?

Targeting PCSK6 could be therapeutic in conditions involving abnormal protein activation.