Recombinant Human PDX1

• Cat.No.: PDX1-29672TH
• Product Overview: Recombinant full length protein of Human PDX1 with proprietary tag; predicted MW 58.13 kDa, inclusive of tag.

Specification

• Description: The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4).
• Protein length: 283 amino acids
• Molecular Weight: 58.130kDa inclusive of tags
• Source: Wheat germ
• Tissue specificity: Duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells).
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGR QPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVA HLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLE LEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMK WKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ EPR
• Sequence Similarities: Belongs to the Antp homeobox family. IPF1/XlHbox-8 subfamily.Contains 1 homeobox DNA-binding domain.

Gene Information

• Gene Name: PDX1 pancreatic and duodenal homeobox 1 [ Homo sapiens ]
• Official Symbol: PDX1
• Synonyms: PDX1; pancreatic and duodenal homeobox 1; insulin promoter factor 1, homeodomain transcription factor , IPF1; pancreas/duodenum homeobox protein 1; IDX 1; MODY4; PDX 1; somatostatin transcription factor 1; STF 1
• Gene ID: 3651
• mRNA Refseq: NM_000209
• Protein Refseq: NP_000200
• MIM: 600733
• Uniprot ID: P52945
• Chromosome Location: 13q12.1
• Pathway: Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem
• Function: chromatin binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity

Reviews

08/03/2022

The expression was better at high humidity.

06/18/2022

It is stable in clinical trials.

06/01/2021

It has stable expression in signal transduction.

Q&As

How to study the regulatory mechanism of PDX1?

Studying the regulatory mechanism of PDX1 requires a combination of various experimental methods and techniques, such as gene knockout, transcriptome analysis, and protein-protein interactions.

Do abnormal PDX1 levels suggest some disease?

Abnormal PDX1 levels may indicate pancreas-related diseases such as diabetes, pancreatitis, and pancreatic cancer.

How are mutations in PDX1 detected and analyzed?

Mutations in PDX1 can be detected and analyzed by methods such as whole-genome sequencing or target region sequencing to understand the impact of mutations on protein structure and function.

What are the mutation types of PDX1?

The types of mutations in PDX1 include point mutations, insertions/deletions, duplications, etc., which may cause structural and functional abnormalities of the protein.

Is there a relationship between PDX1 and other genes or proteins?

PDX1 has a complex relationship with other genes or proteins, and can interact with other genes or proteins and participate in a variety of biochemical reactions.

What are the applications of PDX1 in medical treatment?

It can be used as a biomarker in medical treatment to help monitor disease progression and treatment efficacy. In addition, therapeutics targeting PDX1, such as gene therapy or modulating its expression, are also being studied.