Recombinant Human PDX1
Cat.No. : | PDX1-29672TH |
Product Overview : | Recombinant full length protein of Human PDX1 with proprietary tag; predicted MW 58.13 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | The protein encoded by this gene is a transcriptional activator of several genes, including insulin, somatostatin, glucokinase, islet amyloid polypeptide, and glucose transporter type 2. The encoded nuclear protein is involved in the early development of the pancreas and plays a major role in glucose-dependent regulation of insulin gene expression. Defects in this gene are a cause of pancreatic agenesis, which can lead to early-onset insulin-dependent diabetes mellitus (NIDDM), as well as maturity onset diabetes of the young type 4 (MODY4). |
Protein length : | 283 amino acids |
Molecular Weight : | 58.130kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells). |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MNGEEQYYAATQLYKDPCAFQRGPAPEFSASPPACLYMGR QPPPPPPHPFPGALGALEQGSPPDISPYEVPPLADDPAVA HLHHHLPAQLALPHPPAGPFPEGAEPGVLEEPNRVQLPFP WMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLE LEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMK WKKEEDKKRGGGTAVGGGGVAEPEQDCAVTSGEELLALPP PPPPGGAVPPAAPVAAREGRLPPGLSASPQPSSVAPRRPQ EPR |
Sequence Similarities : | Belongs to the Antp homeobox family. IPF1/XlHbox-8 subfamily.Contains 1 homeobox DNA-binding domain. |
Gene Name : | PDX1 pancreatic and duodenal homeobox 1 [ Homo sapiens ] |
Official Symbol : | PDX1 |
Synonyms : | PDX1; pancreatic and duodenal homeobox 1; insulin promoter factor 1, homeodomain transcription factor , IPF1; pancreas/duodenum homeobox protein 1; IDX 1; MODY4; PDX 1; somatostatin transcription factor 1; STF 1; |
Gene ID : | 3651 |
mRNA Refseq : | NM_000209 |
Protein Refseq : | NP_000200 |
MIM : | 600733 |
Uniprot ID : | P52945 |
Chromosome Location : | 13q12.1 |
Pathway : | Developmental Biology, organism-specific biosystem; Diabetes pathways, organism-specific biosystem; FOXA2 and FOXA3 transcription factor networks, organism-specific biosystem; Insulin Synthesis and Processing, organism-specific biosystem; Maturity onset diabetes of the young, organism-specific biosystem; |
Function : | chromatin binding; sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; |
Products Types
◆ Recombinant Protein | ||
Pdx1-2749R | Recombinant Rat Pdx1 Protein, His&GST-tagged | +Inquiry |
PDX1-4022R | Recombinant Rat PDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Pdx1-4780M | Recombinant Mouse Pdx1 Protein, Myc/DDK-tagged | +Inquiry |
PDX1-6619M | Recombinant Mouse PDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDX1-1642H | Recombinant Human PDX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Lysates | ||
PDX1-3318HCL | Recombinant Human PDX1 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (6)
Ask a questionStudying the regulatory mechanism of PDX1 requires a combination of various experimental methods and techniques, such as gene knockout, transcriptome analysis, and protein-protein interactions.
Abnormal PDX1 levels may indicate pancreas-related diseases such as diabetes, pancreatitis, and pancreatic cancer.
Mutations in PDX1 can be detected and analyzed by methods such as whole-genome sequencing or target region sequencing to understand the impact of mutations on protein structure and function.
The types of mutations in PDX1 include point mutations, insertions/deletions, duplications, etc., which may cause structural and functional abnormalities of the protein.
PDX1 has a complex relationship with other genes or proteins, and can interact with other genes or proteins and participate in a variety of biochemical reactions.
It can be used as a biomarker in medical treatment to help monitor disease progression and treatment efficacy. In addition, therapeutics targeting PDX1, such as gene therapy or modulating its expression, are also being studied.
Customer Reviews (3)
Write a reviewThe expression was better at high humidity.
It is stable in clinical trials.
It has stable expression in signal transduction.
Ask a Question for All PDX1 Products
Required fields are marked with *
My Review for All PDX1 Products
Required fields are marked with *
Inquiry Basket