Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human PPP2R2B, His-tagged

Cat.No. : PPP2R2B-27570TH
Product Overview : Recombinant fragment, corresponding to amino acids 1-278 of Human PPP2R2B with an N-terminal His tag; MWt 32 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The product of this gene belongs to the phosphatase 2 regulatory subunit B family. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity. This gene encodes a beta isoform of the regulatory subunit B55 subfamily. Defects in this gene cause autosomal dominant spinocerebellar ataxia 12 (SCA12), a disease caused by degeneration of the cerebellum, sometimes involving the brainstem and spinal cord, and in resulting in poor coordination of speech and body movements. Multiple alternatively spliced variants, which encode different isoforms, have been identified for this gene. The 5 UTR of some of these variants includes a CAG trinucleotide repeat sequence (7-28 copies) that can be expanded to 66-78 copies in cases of SCA12.
Conjugation : HIS
Source : E. coli
Form : Lyophilised:Reconstitute with 71 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MEEDIDTRKINNSFLRDHSYATEADIISTVEFNHTGELLA TGDKGGRVVIFQREQESKNQVHRRGEYNVYSTFQSHEP EFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVK LWKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLR PMDLMVEATPRRVFANAHTYHINSISVNSDYETYMSADDL RINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHP HHCNTFVYSSSKGTIRLCDMRASALCDRHTKFFEEPED PSNRSFFS
Gene Name : PPP2R2B protein phosphatase 2, regulatory subunit B, beta [ Homo sapiens ]
Official Symbol : PPP2R2B
Synonyms : PPP2R2B; protein phosphatase 2, regulatory subunit B, beta; protein phosphatase 2 (formerly 2A), regulatory subunit B (PR 52), beta isoform , protein phosphatase 2 (formerly 2A), regulatory subunit B, beta isoform , SCA12, spinocerebellar ataxia 12; ser
Gene ID : 5521
mRNA Refseq : NM_001127381
Protein Refseq : NP_001120853
MIM : 604325
Uniprot ID : Q00005
Chromosome Location : 5q32
Pathway : Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Dopaminergic synapse, organism-specific biosystem; Dopaminergic synapse, conserved biosystem; Glycogen Metabolism, organism-specific biosystem;
Function : protein binding; protein phosphatase type 2A regulator activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All PPP2R2B Products

Required fields are marked with *

My Review for All PPP2R2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends