Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human RAB2B, His-tagged

Cat.No. : RAB2B-30602TH
Product Overview : Recombinant full length Human RAB2B with N terminal His tag; 240 amino acids with tag, Predicted MWt 26.8 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Members of the Rab protein family are nontransforming monomeric GTP-binding proteins of the Ras superfamily that contain 4 highly conserved regions involved in GTP binding and hydrolysis. Rab proteins are prenylated, membrane-bound proteins involved in vesicular fusion and trafficking; see MIM 179508.
Protein length : 216 amino acids
Conjugation : HIS
Molecular Weight : 26.800kDa inclusive of tags
Source : E. coli
Tissue specificity : Expressed in kidney, prostate, lung, liver, thymus, colon, pancreas, and skeletal muscle, and low levels in placenta. Not detected in heart, brain, spleen, testis, ovary, small intestine and leukocyte.
Form : Liquid
Purity : >95% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 10% Glycerol, 0.02% DTT, 0.88% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSHMTYAYLFKYIIIGDTG VGKSCLLLQFTDKRFQPVHDLTIGVEFGARMVNIDGKQIK LQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRETFNH LTSWLEDARQHSSSNMVIMLIGNKSDLESRRDVKREEGEA FAREHGLIFMETSAKTACNVEEAFINTAKEIYRKIQQGLF DVHNEANGIKIGPQQSISTSVGPSASQRNSRDIGSNSGCC
Sequence Similarities : Belongs to the small GTPase superfamily. Rab family.
Gene Name : RAB2B RAB2B, member RAS oncogene family [ Homo sapiens ]
Official Symbol : RAB2B
Synonyms : RAB2B; RAB2B, member RAS oncogene family; ras-related protein Rab-2B; FLJ14824;
Gene ID : 84932
mRNA Refseq : NM_001163380
Protein Refseq : NP_001156852
MIM : 607466
Uniprot ID : Q8WUD1
Chromosome Location : 14q11.1
Function : GTP binding; nucleotide binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All RAB2B Products

Required fields are marked with *

My Review for All RAB2B Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends