Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human RTKN, His-tagged

Cat.No. : RTKN-27495TH
Product Overview : Recombinant fragment, corresponding to amino acids 110-405 (296 amino acids) of Human RTKN with an N terminal His tag. Predicted MWt: 33 kDa;
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a scaffold protein that interacts with GTP-bound Rho proteins. Binding of this protein inhibits the GTPase activity of Rho proteins. This protein may interfere with the conversion of active, GTP-bound Rho to the inactive GDP-bound form by RhoGAP. Rho proteins regulate many important cellular processes, including cytokinesis, transcription, smooth muscle contraction, cell growth and transformation. Dysregulation of the Rho signal transduction pathway has been implicated in many forms of cancer. Alternative splicing results in multiple transcript variants encoding different isoforms.
Conjugation : HIS
Source : E. coli
Tissue specificity : Highly expressed in prostate, moderately in kidney, heart, brain, spleen, testis, placenta, small intestine, pancreas, skeletal muscle and peripheral blood leukocytes, and weakly in ovary, colon and thymus. Weakly expressed in all normal cell lines tested
Form : Lyophilised:Reconstitution with 159 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : QDTEMILVDRTLTDISFQSNVLFAEAGPDFELRLELYGAC VEEEGALTGGPKRLATKLSSSLGRSSGRRVRASLDSAG GSGSSPILLPTPVVGGPRYHLLAHTTLTLAAVQDGFRT HDLTLASHEENPAWLPLYGSVCCRLAAQPLCMTQPTAS GTLRVQQAGEMQNWAQVHGVLKGTNLFCYRQPEDADTGEE PLLTIAVNKETRVRAGELDQALGRPFTLSISNQYGDDE VTHTLQTESREALQSWMEALWQLFFDMSQWKQCCDEIM KIETPAPRKPPQALAKQGSLYHEMAI
Sequence Similarities : Contains 1 PH domain.Contains 1 REM (Hr1) repeat.
Gene Name : RTKN rhotekin [ Homo sapiens ]
Official Symbol : RTKN
Synonyms : RTKN; rhotekin; B5;
Gene ID : 6242
mRNA Refseq : NM_001015055
Protein Refseq : NP_001015055
MIM : 602288
Uniprot ID : Q9BST9
Chromosome Location : 2p13.1
Pathway : Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; G13 Signaling Pathway, organism-specific biosystem;
Function : GTP binding; GTP-Rho binding; GTPase inhibitor activity; nucleotide binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
Is RTKN a potential therapeutic target in cancer treatment? 02/05/2019

Some studies propose RTKN as a potential therapeutic target for cancer, as inhibiting its activity may impede tumor progression.

How does RTKN contribute to cellular signaling pathways? 11/13/2018

RTKN is known to modulate signaling pathways, including those associated with cell survival, proliferation, and differentiation.

How is RTKN linked to neurodegenerative diseases? 08/26/2017

Some studies suggest that RTKN may be associated with neurodegenerative disorders, possibly influencing neuronal function.

Are there any known genetic mutations in the RTKN gene associated with diseases? 02/10/2017

Genetic variations in the RTKN gene have been investigated for potential links to certain diseases, but more research is needed to establish clear associations.

Can RTKN be targeted for drug development? 02/29/2016

The potential for developing drugs targeting RTKN is being explored, with a focus on its role in diseases such as cancer.

Customer Reviews (3)

Write a review
Reviews
07/21/2022

    They can offer specialized formulations, concentrations, or modifications of RTKN protein to suit unique experimental requirements.

    03/23/2022

      Collaborative discussions with the manufacturer can also help optimize experimental protocols and provide insights into the best practices in working with RTKN.

      12/27/2021

        The manufacturer can further support researchers by providing customized solutions tailored to their specific needs.

        Ask a Question for All RTKN Products

        Required fields are marked with *

        My Review for All RTKN Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends