Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Pan-species (General) GFP Protein, His-tagged

Cat.No. : GFP-2760P
Product Overview : Recombinant Pan-species (General) GFP Protein (S-Met1-Lys238myc-FLAG tag) with a N-His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
Description : Green Fluorescent Protein (GFP) is a versatile biological marker for monitoring physiological processes, visualizing protein localization, and detecting transgenic expression in vivo.
Source : E. coli
Species : Pan-species (General)
Tag : N-His
Form : Freeze-dried powder
Molecular Mass : Predicted Molecular Mass: 34.3 kDa
Accurate Molecular Mass: 37 kDa
Protein length : S-Met1-Lys238myc-FLAG tag
Purity : > 90%
Stability : The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37 centigrade for 48h, and no obvious degradation and precipitation were observed. The loss rate is less than 5% within the expiration date under appropriate storage condition.
Storage : Avoid repeated freeze/thaw cycles. Store at 2-8 centigrade for one month. Aliquot and store at -80 centigrade for 12 months.
Storage Buffer : 20mM Tris, 150mM NaCl, pH8.0, containing 1mM EDTA, 1mM DTT, 0.01% SKL, 5% Trehalose and Proclin300.
Reconstitution : Reconstitute in 20mM Tris, 150mM NaCl (pH8.0) to a concentration of 0.1-1.0 mg/mL. Do not vortex.
Official Symbol : GFP
Synonyms : Green Fluorescent Protein; GFP
Official Symbol : GFP
Synonyms : Green Fluorescent Protein; GFP

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends