Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

GFP

  • Official Full Name

    Green Fluorescent Protein

  • Overview

    Green fluorescence protein (GFP) is a 27 kDa protein derived from the jellyfish Aequorea victoria, which emits green light (emission peak at a wavelenth of 509 nm) when excited by blue light (excitation peak at a wavelenth of 395 nm). GFP has become an invaluable tool in cell biology research, since its intrinsic fluorescence can be visualized in living cells. GFP fluorescence is stable under fixation conditions and suitable for a variety of applications. GFP has been widely used as a reporter for gene expression, enabling researchers to visualize and localize GFP-tagged proteins within living cells without the need for chemical staining. Other applications of GFP include assessment of protein protein interactions through the yeast two hybrid system and measurement of distance between proteins through fluorescence energy transfer (FRET) protocols. GFP technnology has considerably contributed to a greater understanding of cellular physiology. YFP differs from GFP due to a mutation at T203Y; antibodies raised against full-length GFP should also detect YFP and other variants.
  • Synonyms

    GFP; Green Fluorescent Protein;

  • Recombinant Proteins
  • Fluorescent Proteins
  • Native Proteins
  • Assay Kits
  • Aequorea victoria
  • Bacterial
  • Bovine
  • Human
  • Jellyfish
  • Jellyfish Aequorea Victoria
  • Pan-species (General)
  • bovine Spinal Cord
  • E. coli
  • E.coli
  • HEK293
  • Mamanlian cells
  • P.pastoris
  • Saccharomyces
  • Yeast
  • Arginine|His
  • C
  • His
  • Flag
  • GST
  • His|HA|Flag|GST|Myc
  • SUMO
  • N/A
  • N
Species Cat.# Product name Source (Host) Tag Protein Length Price
Human GFP-430 Active Recombinant Human GFP/SNAP25B/VAMP-2 protein, His-tagged E.coli His
Aequorea victoria GFP-03A Active Recombinant Aequorea victoria GFP protein, His-tagged E.coli His Ser2-Lys238
Aequorea victoria GFP-11 Recombinant GFP Protein E.coli His 238 amino acids
Aequorea victoria GFP-1031A Recombinant Aequorea victoria GFP protein(Met1-Leu238), His-tagged E. coli C-His Met1-Leu238
Aequorea victoria GFP-1167A Recombinant Aequorea victoria GFP Protein (Met1-Lys239), C-His tagged E.coli C-His Met1-Lys239
Aequorea victoria GFP-11A Recombinant Aequorea victoria GFP Protein E.coli N/A 1-238 aa
Bacterial GFP-12 Recombinant Bacteria GFP Protein E.coli His
Bovine GFP-36B Native Bovine GFP bovine Spinal Cord N/A
Jellyfish GFP-4012J Recombinant Jellyfish GFP protein, His-SUMO-tagged E.coli His-SUMO 1-238aa
Jellyfish GFP-5647J Recombinant Jellyfish GFP protein, His-tagged Yeast His 1-238aa
Jellyfish Aequorea Victoria GFP-83H Recombinant GFP protein, Arginine/His-tagged E.coli Arginine/His
Pan-species (General) GFP-2761P Recombinant Pan-species (General) GFP Protein, His-tagged E.coli N-His
Pan-species (General) GFP-2760P Recombinant Pan-species (General) GFP Protein, His-tagged E.coli N-His S-Met1-Lys238myc-FLAG tag
GFP-27H Active Recombinant EGFP-rProtein A, His-tagged E.coli His
GFP-154 Recombinant Green Fluorescent Protein E.coli N/A 238 aa
GFP-21 Recombinant green fluorescent protein HEK293 Flag
Kit-0364 GFP Quantitation Kit N/A
GFP-2220 Recombinant PolyTag-GFP Protein His/HA/Flag/GST/Myc
GFP-159 Recombinant Green Fluorescent Protein P.pastoris N/A 237 aa
GFP-160 Recombinant Green Fluorescent Protein Saccharomyces N/A 237 aa
GFP-189 Recombinant Green Fluorescent Protein E.coli N/A 237 aa
GFP-7050FL Recombinant Full Length GFP, Flag-tagged Mamanlian cells Flag
GFP-161 Recombinant Green Fluorescent Protein E.coli N/A 234 aa
GFP-162 Recombinant Green Fluorescent Protein E.coli N/A 222 aa
GFP-301136 Recombinant GFP protein, GST-tagged E.coli GST Met1-Lys239
  • GFP Related Articles

GFP involved in several pathways and played different roles in them. We selected most pathways GFP participated on our site, such as , which may be useful for your reference. Also, other proteins which involved in the same pathway with GFP were listed below. Creative BioMart supplied nearly all the proteins listed, you can search them on our site.

Pathway Name Pathway Related Protein

GFP has several biochemical functions, for example, . Some of the functions are cooperated with other proteins, some of the functions could acted by GFP itself. We selected most functions GFP had, and list some proteins which have the same functions with GFP. You can find most of the proteins on our site.

Function Related Protein

GFP has direct interactions with proteins and molecules. Those interactions were detected by several methods such as yeast two hybrid, co-IP, pull-down and so on. We selected proteins and molecules interacted with GFP here. Most of them are supplied by our site. Hope this information will be useful for your research of GFP.

Rafiee, MR; Shafaroudi, AM; et al. Enrichment of A Rare Subpopulation of miR-302-Expressing Glioma Cells by Serum Deprivation. CELL JOURNAL 16:494-505(2015).
Jiang, JM; Lin, YX; et al. Proteomics approach reveals mechanism underlying susceptibility of loquat fruit to sunburn during color changing period. FOOD CHEMISTRY 176:388-395(2015).
  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All GFP Products

Required fields are marked with *

My Review for All GFP Products

Required fields are marked with *

logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends