Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human CFL2 Protein

Cat.No. : CFL2-73HF
Product Overview : Recombinant full length Human Cofilin 2 with N terminal proprietary tag; Predicted MWt 44.33 kDa including the tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 44.330kDa inclusive of tags
Protein Length : 166 amino acids
AA Sequence : MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCL SDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : CFL2 cofilin 2 (muscle) [ Homo sapiens ]
Official Symbol : CFL2
Synonyms : CFL2; cofilin 2 (muscle); cofilin-2
Gene ID : 1073
mRNA Refseq : NM_001243645
Protein Refseq : NP_001230574
MIM : 601443
UniProt ID : Q9Y281

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
Are there any ongoing clinical trials targeting CFL2 for therapeutic purposes? 06/08/2022

It's important to check current clinical trial databases for the latest information, but research exploring CFL2 as a therapeutic target is ongoing.

How does CFL2 relate to cardiac diseases? 03/13/2022

CFL2 is involved in maintaining the structure and function of cardiac muscle cells, and its dysregulation has been linked to conditions such as cardiomyopathies.

Are there diagnostic applications for CFL2 in muscle-related disorders? 11/09/2018

Research suggests that analyzing CFL2 levels and activity could serve as diagnostic markers for certain muscle-related disorders.

How does CFL2 interact with other proteins in the context of muscle function? 04/13/2018

CFL2 interacts with actin and other regulatory proteins to modulate the dynamics of the actin cytoskeleton, influencing cellular processes crucial for muscle function.

Can CFL2 be a potential therapeutic target for muscle-related disorders? 02/28/2017

Investigating CFL2 as a therapeutic target is an active area of research, with the aim of developing interventions for conditions characterized by impaired muscle function.

Customer Reviews (3)

Write a review
Reviews
05/23/2022

    It has been extensively used in protein-protein interaction studies, enzymatic assays, and structural analyses, showcasing its reliability and adaptability in diverse research areas.

    11/13/2021

      I am certain of obtaining reliable and reproducible results, enabling me to contribute to scientific progress and make new discoveries.

      11/07/2017

        I highly recommend the CFL2 Protein for its outstanding performance in ELISA assays.

        Ask a Question for All CFL2 Products

        Required fields are marked with *

        My Review for All CFL2 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends