Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human CLDN3 Protein

Cat.No. : CLDN3-84HF
Product Overview : Recombinant full length Human Claudin 3 with an N terminal proprietary tag; Predicted MWt 50.31 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this intronless gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is also a low-affinity receptor for Clostridium perfringens enterotoxin, and shares aa sequence similarity with a putative apoptosis-related protein found in rat.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 50.310kDa inclusive of tags
Protein Length : 220 amino acids
AA Sequence : MSMGLEITGTALAVLGWLGTIVCCALPMWRVSAFIGSNII TSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR ALIVVAILLAAFGLLVALVGAQCTNCVQDDTAKAKITIVA GVLFLLAALLTLVPVSWSANTIIRDFYNPVVPEAQKREMG AGLYVGWAAAALQLLGGALLCCSCPPREKKYTATKVVYSA PRSTGPGASLGTGYDRKDYV
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : CLDN3 claudin 3 [ Homo sapiens ]
Official Symbol : CLDN3
Synonyms : CLDN3; claudin 3; C7orf1, CPETR2; claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE R2; CPE receptor 2; HRVP1; RVP1; ventral prostate.1 like protein
Gene ID : 1365
mRNA Refseq : NM_001306
Protein Refseq : NP_001297
MIM : 602910
UniProt ID : O15551

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (5)

Ask a question
Is CLDN3 a potential target for drug delivery to specific tissues? 05/06/2021

Researchers are exploring the use of CLDN3 as a target for drug delivery systems, aiming to enhance the specificity of drug delivery to tissues expressing high levels of CLDN3.

How does CLDN3 impact the permeability of the intestinal epithelium? 01/15/2021

CLDN3 is involved in the tight junctions of intestinal epithelial cells, influencing the permeability of the intestinal barrier and playing a role in conditions like IBD.

In which other diseases or conditions is CLDN3 being investigated? 04/16/2019

CLDN3 is under investigation in various conditions, including infectious diseases, where its role in tight junctions may have implications for host-pathogen interactions.

Can CLDN3 be involved in inflammatory bowel diseases (IBD)? 02/02/2018

Yes, CLDN3 is implicated in the pathogenesis of inflammatory bowel diseases, and its expression levels are being studied as potential markers for disease severity.

How is CLDN3 linked to neurodegenerative diseases? 10/26/2016

Altered expression of CLDN3 in the blood-brain barrier is associated with certain neurodegenerative diseases, making it a subject of interest for researchers studying these conditions.

Customer Reviews (3)

Write a review
Reviews
04/24/2019

    The manufacturer's deep understanding of the protein and its applications enables them to promptly and effectively address any issues that may arise during my trials.

    06/30/2018

      It minimizes the risk of protein degradation and maximizes the effectiveness of the protein in various applications, such as cell signaling pathways or metabolic studies.

      12/12/2017

        This stability is particularly advantageous for long-term studies or experiments involving extended incubation periods.

        Ask a Question for All CLDN3 Products

        Required fields are marked with *

        My Review for All CLDN3 Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends