Recombinant Full Length Human RXRG Protein
Cat.No. : | RXRG-451HF |
Product Overview : | Recombinant full length Human Retinoid X Receptor gamma with N terminal proprietary tag; Predicted MWt 77.00 kDa incusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternatively spliced transcript variants have been described. |
Source : | In Vitro Cell Free System |
Species : | Human |
Form : | Liquid |
Molecular Mass : | 77.000kDa inclusive of tags |
Protein Length : | 463 amino acids |
AA Sequence : | MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMD SHPSYTDTPVSAPRTLSAVGTPLNALGSPYRVITSAMGPP SGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCK GFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCL VMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTL VEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVS VQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYAT LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFF KLIGDTPIDTFLMEMLETPLQIT |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name : | RXRG retinoid X receptor, gamma [ Homo sapiens ] |
Official Symbol : | RXRG |
Synonyms : | RXRG; retinoid X receptor, gamma; retinoic acid receptor RXR-gamma; NR2B3 |
Gene ID : | 6258 |
mRNA Refseq : | NM_006917 |
Protein Refseq : | NP_008848 |
MIM : | 180247 |
UniProt ID : | P48443 |
Products Types
◆ Recombinant Protein | ||
RXRG-3878R | Recombinant Rhesus Macaque RXRG Protein, His (Fc)-Avi-tagged | +Inquiry |
RXRG-1932H | Recombinant Human RXRG Protein, His (Fc)-Avi-tagged | +Inquiry |
Rxrg-5660M | Recombinant Mouse Rxrg Protein, Myc/DDK-tagged | +Inquiry |
RXRG-4867R | Recombinant Rat RXRG Protein, His (Fc)-Avi-tagged | +Inquiry |
RXRG-5208R | Recombinant Rat RXRG Protein | +Inquiry |
◆ Lysates | ||
RXRG-2097HCL | Recombinant Human RXRG 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (7)
Ask a questionGenetic mutations in RXRG can disrupt its regulatory roles, leading to various developmental and metabolic disorders.
RXRG is key in regulating lipid and glucose metabolism, playing a role in metabolic homeostasis.
RXRG is essential in embryonic development and organ formation, guiding cell fate decisions.
RXRG functions as a nuclear receptor, regulating gene expression in response to ligand binding.
Targeting RXRG in therapy offers potential in treating metabolic syndromes and degenerative diseases.
It interacts with retinoids to modulate vitamin A metabolism, influencing cellular differentiation and proliferation.
It influences immune function by affecting the development and differentiation of immune cells.
Customer Reviews (3)
Write a reviewAids in groundbreaking discoveries, highly recommended.
Outstanding protein analysis, a research asset.
Enables data-driven decisions in our research.
Ask a Question for All RXRG Products
Required fields are marked with *
My Review for All RXRG Products
Required fields are marked with *
Inquiry Basket