Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Full Length Human RXRG Protein

Cat.No. : RXRG-451HF
Product Overview : Recombinant full length Human Retinoid X Receptor gamma with N terminal proprietary tag; Predicted MWt 77.00 kDa incusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene encodes a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the antiproliferative effects of retinoic acid (RA). This receptor forms dimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements. This gene is expressed at significantly lower levels in non-small cell lung cancer cells. Alternatively spliced transcript variants have been described.
Source : In Vitro Cell Free System
Species : Human
Form : Liquid
Molecular Mass : 77.000kDa inclusive of tags
Protein Length : 463 amino acids
AA Sequence : MYGNYSHFMKFPAGYGGSPGHTGSTSMSPSAALSTGKPMD SHPSYTDTPVSAPRTLSAVGTPLNALGSPYRVITSAMGPP SGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCK GFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCL VMGMKREAVQEERQRSRERAESEAECATSGHEDMPVERIL EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTL VEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVS VQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYAT LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFF KLIGDTPIDTFLMEMLETPLQIT
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name : RXRG retinoid X receptor, gamma [ Homo sapiens ]
Official Symbol : RXRG
Synonyms : RXRG; retinoid X receptor, gamma; retinoic acid receptor RXR-gamma; NR2B3
Gene ID : 6258
mRNA Refseq : NM_006917
Protein Refseq : NP_008848
MIM : 180247
UniProt ID : P48443

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (7)

Ask a question
How do variations in the RXRG gene affect its function and contribute to disease? 03/28/2023

Genetic mutations in RXRG can disrupt its regulatory roles, leading to various developmental and metabolic disorders.

What is the significance of RXRG in the regulation of metabolic pathways and homeostasis? 06/28/2022

RXRG is key in regulating lipid and glucose metabolism, playing a role in metabolic homeostasis.

What role does RXRG play in developmental processes and organogenesis? 12/19/2021

RXRG is essential in embryonic development and organ formation, guiding cell fate decisions.

What is the primary function of RXRG in cellular signaling and gene regulation? 03/04/2021

RXRG functions as a nuclear receptor, regulating gene expression in response to ligand binding.

What potential does RXRG have as a therapeutic target in metabolic and degenerative diseases? 11/18/2019

Targeting RXRG in therapy offers potential in treating metabolic syndromes and degenerative diseases.

How does RXRG interact with retinoids and what is its role in vitamin A metabolism? 12/18/2017

It interacts with retinoids to modulate vitamin A metabolism, influencing cellular differentiation and proliferation.

How does RXRG contribute to the immune system's function and response? 07/08/2017

It influences immune function by affecting the development and differentiation of immune cells.

Customer Reviews (3)

Write a review
Reviews
05/07/2018

    Aids in groundbreaking discoveries, highly recommended.

    12/29/2017

      Outstanding protein analysis, a research asset.

      08/01/2017

        Enables data-driven decisions in our research.

        Ask a Question for All RXRG Products

        Required fields are marked with *

        My Review for All RXRG Products

        Required fields are marked with *

        0

        Inquiry Basket

        cartIcon
        logo

        FOLLOW US

        Terms and Conditions        Privacy Policy

        Copyright © 2024 Creative BioMart. All Rights Reserved.

        Contact Us

        • /

        Stay Updated on the Latest Bioscience Trends