Recombinant Human APLN protein, GST-tagged

• Cat.No.: APLN-301470H
• Product Overview: Recombinant Human APLN (38-77 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Protein length: Asn38-Phe77
• AA Sequence: NVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: APLN apelin [ Homo sapiens ]
• Official Symbol: APLN
• Synonyms: APLN; apelin; apelin, AGTRL1 ligand; XNPEP2; AGTRL1 ligand; APJ endogenous ligand; APEL
• Gene ID: 8862
• mRNA Refseq: NM_017413
• Protein Refseq: NP_059109
• MIM: 300297
• UniProt ID: Q9ULZ1

Reviews

12/16/2022

Western blot experiments using this protein can obtain clearly distinguishable bands, indicating that it has high clarity and legibility.

02/10/2022

In the course of repeated experiments, the stability of this protein has remained consistent, which provides us with great convenience.

12/12/2019

I appreciate the manufacturer's pursuit of product quality, and their product repeatability is very good, which makes me more confident in the experimental results.

Q&As

Does the study of APLN involve genetic engineering technology?

Yes, genetic engineering techniques are often used to produce APLN s.

Does APLN interact with other drugs?

There may be interactions, and it is recommended to avoid concurrent use of other drugs during use, especially those that affect the cardiovascular system.

What is the action mechanism of APLN ?

APLN promotes cardiovascular protection and anti-tumor effects by binding to APJ receptors.

In what diseases might APLN have potential applications?

APLN has potential applications in the treatment of cardiovascular diseases, tumors and metabolic diseases.

In what way can APLN be administered?

APLN can be administered intravenously or subcutaneously.

What is the dose of APLN to treat cardiovascular disease?

Dosage should be determined according to the specific situation, it is recommended to consult with a professional doctor.

Does the development of APLN involve animal experiments?

In the development process, it usually goes through a series of animal experiments to verify its effectiveness and safety.

What are the side effects of APLN ?

Common side effects include injection site pain, fever, nausea, etc., but most patients tolerate them well.

What is the protective effect of APLN on cardiovascular diseases?

APLN can promote blood vessel dilation, inhibit inflammatory response, and facilitate the survival and repair of cardiomyocytes.

Has the application of APLN in tumor therapy been clinically verified?

There are currently no large-scale clinical trials to confirm its use in cancer treatment, but preliminary research results are promising.