Recombinant Human APLN protein, GST-tagged
Cat.No. : | APLN-301470H |
Product Overview : | Recombinant Human APLN (38-77 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Source : | E. coli |
Species : | Human |
Tag : | GST |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Protein length : | Asn38-Phe77 |
AA Sequence : | NVRHLVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name : | APLN apelin [ Homo sapiens ] |
Official Symbol : | APLN |
Synonyms : | APLN; apelin; apelin, AGTRL1 ligand; XNPEP2; AGTRL1 ligand; APJ endogenous ligand; APEL; |
Gene ID : | 8862 |
mRNA Refseq : | NM_017413 |
Protein Refseq : | NP_059109 |
MIM : | 300297 |
UniProt ID : | Q9ULZ1 |
Products Types
◆ Recombinant Protein | ||
APLN-370R | Recombinant Rat APLN Protein, His (Fc)-Avi-tagged | +Inquiry |
APLN-186R | Recombinant Rhesus Macaque APLN Protein, His (Fc)-Avi-tagged | +Inquiry |
APLN-7588Z | Recombinant Zebrafish APLN | +Inquiry |
APLN-8261H | Recombinant Human APLN protein, His-tagged | +Inquiry |
Apln-8264R | Recombinant Rat Apln protein, His & S-tagged | +Inquiry |
◆ Lysates | ||
APLN-8792HCL | Recombinant Human APLN 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (10)
Ask a questionYes, genetic engineering techniques are often used to produce APLN s.
There may be interactions, and it is recommended to avoid concurrent use of other drugs during use, especially those that affect the cardiovascular system.
APLN promotes cardiovascular protection and anti-tumor effects by binding to APJ receptors.
APLN has potential applications in the treatment of cardiovascular diseases, tumors and metabolic diseases.
APLN can be administered intravenously or subcutaneously.
Dosage should be determined according to the specific situation, it is recommended to consult with a professional doctor.
In the development process, it usually goes through a series of animal experiments to verify its effectiveness and safety.
Common side effects include injection site pain, fever, nausea, etc., but most patients tolerate them well.
APLN can promote blood vessel dilation, inhibit inflammatory response, and facilitate the survival and repair of cardiomyocytes.
There are currently no large-scale clinical trials to confirm its use in cancer treatment, but preliminary research results are promising.
Customer Reviews (3)
Write a reviewWestern blot experiments using this protein can obtain clearly distinguishable bands, indicating that it has high clarity and legibility.
In the course of repeated experiments, the stability of this protein has remained consistent, which provides us with great convenience.
I appreciate the manufacturer's pursuit of product quality, and their product repeatability is very good, which makes me more confident in the experimental results.
Ask a Question for All APLN Products
Required fields are marked with *
My Review for All APLN Products
Required fields are marked with *
Inquiry Basket