Recombinant Human CFL2
Cat.No. : | CFL2-26779TH |
Product Overview : | Recombinant full length Human Cofilin 2 with N terminal proprietary tag; Predicted MWt 44.33 kDa including the tag. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes an intracellular protein that is involved in the regulation of actin-filament dynamics. This protein is a major component of intranuclear and cytoplasmic actin rods. It can bind G- and F-actin in a 1:1 ratio of cofilin to actin, and it reversibly controls actin polymerization and depolymerization in a pH-dependent manner. Mutations in this gene cause nemaline myopathy type 7, a form of congenital myopathy. Alternative splicing results in multiple transcript variants. |
Protein length : | 166 amino acids |
Molecular Weight : | 44.330kDa inclusive of tags |
Source : | Wheat germ |
Tissue specificity : | Isoform CFL2b is expressed predominantly in skeletal muscle and heart. Isoform CFL2a is expressed in various tissues. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MASGVTVNDEVIKVFNDMKVRKSSTQEEIKKRKKAVLFCL SDDKRQIIVEEAKQILVGDIGDTVEDPYTSFVKLLPLNDC RYALYDATYETKESKKEDLVFIFWAPESAPLKSKMIYASS KDAIKKKFTGIKHEWQVNGLDDIKDRSTLGEKLGGNVVVS LEGKPL |
Sequence Similarities : | Belongs to the actin-binding proteins ADF family.Contains 1 ADF-H domain. |
Gene Name : | CFL2 cofilin 2 (muscle) [ Homo sapiens ] |
Official Symbol : | CFL2 |
Synonyms : | CFL2; cofilin 2 (muscle); cofilin-2; |
Gene ID : | 1073 |
mRNA Refseq : | NM_001243645 |
Protein Refseq : | NP_001230574 |
MIM : | 601443 |
Uniprot ID : | Q9Y281 |
Chromosome Location : | 14q13.2 |
Pathway : | Axon guidance, organism-specific biosystem; Axon guidance, conserved biosystem; Caspase cascade in apoptosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, organism-specific biosystem; Fc gamma R-mediated phagocytosis, conserved biosystem; |
Function : | actin binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
CFL2-6905H | Recombinant Human CFL2 protein(Ala2-Leu166), His-tagged | +Inquiry |
CFL2-1615M | Recombinant Mouse CFL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CFL2-655R | Recombinant Rhesus Macaque CFL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CFL2-1174H | Recombinant Human CFL2 Protein, GST-Tagged | +Inquiry |
Cfl2-881M | Recombinant Mouse Cfl2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Lysates | ||
CFL2-7554HCL | Recombinant Human CFL2 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
- Q&As
- Reviews
Q&As (5)
Ask a questionIt's important to check current clinical trial databases for the latest information, but research exploring CFL2 as a therapeutic target is ongoing.
CFL2 is involved in maintaining the structure and function of cardiac muscle cells, and its dysregulation has been linked to conditions such as cardiomyopathies.
Research suggests that analyzing CFL2 levels and activity could serve as diagnostic markers for certain muscle-related disorders.
CFL2 interacts with actin and other regulatory proteins to modulate the dynamics of the actin cytoskeleton, influencing cellular processes crucial for muscle function.
Investigating CFL2 as a therapeutic target is an active area of research, with the aim of developing interventions for conditions characterized by impaired muscle function.
Customer Reviews (3)
Write a reviewIt has been extensively used in protein-protein interaction studies, enzymatic assays, and structural analyses, showcasing its reliability and adaptability in diverse research areas.
I am certain of obtaining reliable and reproducible results, enabling me to contribute to scientific progress and make new discoveries.
I highly recommend the CFL2 Protein for its outstanding performance in ELISA assays.
Ask a Question for All CFL2 Products
Required fields are marked with *
My Review for All CFL2 Products
Required fields are marked with *
Inquiry Basket