Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human INS therapeutic protein

Cat.No. : INS-P040H
Product Overview : Recombinant Human INS therapeutic protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
Description : The expression product is the active ingredient of Novolin R.
Source : E. coli
Species : Human
Molecular Mass : 5.8 kDa
Protein length : 30 aa
AA Sequence : FVNQHLCGSHLVEALYLVCGERGFFYTPKT
Endotoxin : < 1.0 EU per μg of the protein
Purity : >95%
Storage : Can be stored at +4 centigrade short term (1-2weeks). For long term storage, aliquot and store at -20 centigrade or -70 centigrade. Avoidrepeated freezing and thawing cycles.
Gene Name : INS insulin [ Homo sapiens ]
Official Symbol : INS
Synonyms : INS; insulin; proinsulin; ILPR; IRDN; IDDM2; MODY10;
Gene ID : 3630
mRNA Refseq : NM_000207
Protein Refseq : NP_000198
UniProt ID : P01308
Chromosome Location : 11p15.5
Pathway : ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, organism-specific biosystem; Aldosterone-regulated sodium reabsorption, conserved biosystem; Amyloids, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function : hormone activity; hormone activity; hormone activity; insulin receptor binding; insulin receptor binding; insulin-like growth factor receptor binding; protein binding;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends