Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SLC25A3

Cat.No. : SLC25A3-31414TH
Product Overview : Recombinant full length Human SLC25A3 with N terminal proprietary tag; Predicted MWt 65.45 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : The protein encoded by this gene catalyzes the transport of phosphate into the mitochondrial matrix, either by proton cotransport or in exchange for hydroxyl ions. The protein contains three related segments arranged in tandem which are related to those found in other characterized members of the mitochondrial carrier family. Both the N-terminal and C-terminal regions of this protein protrude toward the cytosol. Multiple alternatively spliced transcript variants have been isolated.
Protein length : 361 amino acids
Molecular Weight : 65.450kDa inclusive of tags
Source : Wheat germ
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQP RRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHT AVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAK GWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWR TSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLR DAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACCERT VEALYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVS HPADSVVSVLNKEKGSSASLVLKRLGFKGVWKGLFARIIM IGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLT Q
Sequence Similarities : Belongs to the mitochondrial carrier family.Contains 3 Solcar repeats.
Gene Name : SLC25A3 solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3 [ Homo sapiens ]
Official Symbol : SLC25A3
Synonyms : SLC25A3; solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 3; PHC; phosphate carrier protein, mitochondrial;
Gene ID : 5250
mRNA Refseq : NM_002635
Protein Refseq : NP_002626
MIM : 600370
Uniprot ID : Q00325
Chromosome Location : 12q23
Pathway : C-MYB transcription factor network, organism-specific biosystem;
Function : phosphate ion carrier activity; symporter activity;

Products Types

◆ Recombinant Protein
SLC25A3-4068R Recombinant Rhesus Macaque SLC25A3 Protein, His (Fc)-Avi-tagged +Inquiry
Slc25a3-5913M Recombinant Mouse Slc25a3 Protein, Myc/DDK-tagged +Inquiry
SLC25A3-8283M Recombinant Mouse SLC25A3 Protein, His (Fc)-Avi-tagged +Inquiry
SLC25A3-1383C Recombinant Chicken SLC25A3 +Inquiry
SLC25A3-15316M Recombinant Mouse SLC25A3 Protein +Inquiry

See All SLC25A3 Recombinant Protein

◆ Lysates
SLC25A3-1772HCL Recombinant Human SLC25A3 293 Cell Lysate +Inquiry
SLC25A3-1771HCL Recombinant Human SLC25A3 293 Cell Lysate +Inquiry
SLC25A3-1770HCL Recombinant Human SLC25A3 293 Cell Lysate +Inquiry

See All SLC25A3 Lysates

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All SLC25A3 Products

Required fields are marked with *

My Review for All SLC25A3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends