Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human SLC2A4 protein, GST-tagged

Cat.No. : SLC2A4-113H
Product Overview : Recombinant Human SLC2A4(467 a.a. - 509 a.a.)fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
Description : This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM).
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 30.47 kDa
AA Sequence : RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name : SLC2A4 solute carrier family 2 (facilitated glucose transporter), member 4 [ Homo sapiens ]
Official Symbol : SLC2A4
Synonyms : SLC2A4; solute carrier family 2 (facilitated glucose transporter), member 4; GLUT4; solute carrier family 2, facilitated glucose transporter member 4; GLUT-4; insulin-responsive glucose transporter type 4; glucose transporter type 4, insulin-responsive;
Gene ID : 6517
mRNA Refseq : NM_001042
Protein Refseq : NP_001033
MIM : 138190
UniProt ID : P14672
Chromosome Location : 17p13
Pathway : AMPK signaling, organism-specific biosystem; Adipocytokine signaling pathway, organism-specific biosystem; Adipocytokine signaling pathway, conserved biosystem; Adipogenesis, organism-specific biosystem; Arf6 trafficking events, organism-specific biosystem; Class I PI3K signaling events mediated by Akt, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function : D-glucose transmembrane transporter activity; glucose transmembrane transporter activity; protein binding; substrate-specific transmembrane transporter activity;

Products Types

◆ Recombinant Protein
Slc2a4-5920M Recombinant Mouse Slc2a4 Protein, Myc/DDK-tagged +Inquiry
Slc2a4-2695M Recombinant Mouse Slc2a4 Protein, His&GST-tagged +Inquiry
SLC2A4-8314M Recombinant Mouse SLC2A4 Protein, His (Fc)-Avi-tagged +Inquiry
SLC2A4-5157R Recombinant Rat SLC2A4 Protein, His (Fc)-Avi-tagged +Inquiry
SLC2A4-2029H Recombinant Human SLC2A4 Protein, His (Fc)-Avi-tagged +Inquiry

See All SLC2A4 Recombinant Protein

Related Gene

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends