Recombinant Rabbit INS protein

• Cat.No.: INS-4330R
• Product Overview: Recombinant Rabbit INS protein(P01311)(25-54aa) was expressed in E. coli.

Specification

• Source: E. coli
• Species: Rabbit
• Tag: N/A
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 3.4 kDa
• Protein length: 25-54aa
• AA Sequence: FVNQHLCGSHLVEALYLVCGERGFFYTPKS
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: INS insulin [ Oryctolagus cuniculus ]
• Official Symbol: INS
• Synonyms: INS; insulin
• Gene ID: 100009181
• mRNA Refseq: NM_001082335
• Protein Refseq: NP_001075804