Recombinant Rat INS1 Protein (25-54 aa), His-SUMO-tagged
Cat.No. : | INS1-2436R |
Product Overview : | Recombinant Rat INS1 Protein (25-54 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
Description : | Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. |
Source : | E. coli |
Species : | Rat |
Tag : | His-SUMO |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 19.4 kDa |
Protein length : | 25-54 aa |
AA Sequence : | FVKQHLCGPHLVEALYLVCGERGFFYTPKS |
Purity : | > 85% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name : | Ins1 insulin 1 [ Rattus norvegicus ] |
Official Symbol : | INS1 |
Synonyms : | INS1; insulin 1; insulin-1; |
Gene ID : | 24505 |
mRNA Refseq : | NM_019129 |
Protein Refseq : | NP_062002 |
UniProt ID : | P01322 |
Products Types
◆ Recombinant Protein | ||
Proinsulln-01M | Recombinant Mouse Proinsulin (25-108aa) | +Inquiry |
INS1-4560M | Recombinant Mouse INS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
INS1-2256M | Recombinant Mouse INS1 Protein (25-108 aa), His-Myc-tagged | +Inquiry |
INS1-2164M | Recombinant Mouse INS1 Protein (25-108 aa), His-Myc-tagged | +Inquiry |
INS1-2732R | Recombinant Rat INS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket