Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Rat INS1 Protein (25-54 aa), His-SUMO-tagged

Cat.No. : INS1-2436R
Product Overview : Recombinant Rat INS1 Protein (25-54 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Protein Description: Partial.
  • Specification
  • Gene Information
  • Related Products
Description : Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver.
Source : E. coli
Species : Rat
Tag : His-SUMO
Form : Tris-based buffer,50% glycerol
Molecular Mass : 19.4 kDa
Protein length : 25-54 aa
AA Sequence : FVKQHLCGPHLVEALYLVCGERGFFYTPKS
Purity : > 85% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.
Gene Name : Ins1 insulin 1 [ Rattus norvegicus ]
Official Symbol : INS1
Synonyms : INS1; insulin 1; insulin-1;
Gene ID : 24505
mRNA Refseq : NM_019129
Protein Refseq : NP_062002
UniProt ID : P01322

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends