Recombinant Human C, His-tagged

• Cat.No.: C-30019TH
• Product Overview: Recombinant full length protein, corresponding to amino acids 1-126 of Human PGEA1 with an N terminal His tag. Observed mol wt: 23 kDa

Specification

• Description: Beta-catenin is a transcriptional activator and oncoprotein involved in the development of several cancers. The protein encoded by this gene interacts directly with the C-terminal region of beta-catenin, inhibiting oncogenic beta-catenin-mediated transcriptional activation by competing with transcription factors for binding to beta-catenin. Two transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Source: E. coli
• Form: Lyophilised:Reconstitute with 108 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MPFFGNTFSPKKTPPRKSASLSNLHSLDRSTREVELGLEY GSPTMNLAGQSLKFENGQWIAETGVSGGVDRREVQRLR RRNQQLEEENNLLRLKVDILLDMLSESTAESHLMEKELDELRISRKRK

Gene Information

• Gene Name: CBY1 chibby homolog 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: CF8">C
• Synonyms: C; chib; C22orf2, chromosome 22 open reading frame 2 , PGEA1, PKD2 interactor, golgi and endoplasmic reticulum associated 1; protein chibby homolog 1; Cby; Chibby; PIGEA 14; PIGEA14
• Gene ID: 25776
• mRNA Refseq: NM_001002880
• Protein Refseq: NP_001002880
• MIM: 607757
• Uniprot ID: Q9Y3M2
• Chromosome Location: 22q12
• Pathway: Regulation of Wnt-mediated beta catenin signaling and target gene transcription, organism-specific biosystem
• Function: beta-catenin binding; identical protein binding; protein binding